Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SFX6

Protein Details
Accession A0A060SFX6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
200-221AAFVPGRRPKRQRPTPIPDLKLHydrophilic
NLS Segment(s)
PositionSequence
206-210RRPKR
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043141  Ribosomal_L10-like_sf  
IPR001790  Ribosomal_L10P  
Amino Acid Sequences MLSSSSRLLRSPQPVVLVQARTYAISLKPPVVYPNKTGPRRYGERKTYLYNQYTRLLQASFDRPLLLFQHSDFSANRLIQLRADIADAVAKHAKTTAVATPSLAAPGPTPVSSFAPEELPTFTVLRTSLFGVVLREMSQFDDSIRREIAKTVTGSLAVLSFPQLNPPQLKAVLRVLARSIPPREPKTQAQIDEEKKAAEAAFVPGRRPKRQRPTPIPDLKLLGALIEGRLFKAEGVQSVAELPTLDGLRAQIVGLLSAPAMQLSMVLNEASGAKLARTLEGFKKSLEPQEQEGEAPPPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.44
4 0.39
5 0.32
6 0.31
7 0.29
8 0.25
9 0.25
10 0.23
11 0.18
12 0.22
13 0.23
14 0.23
15 0.23
16 0.24
17 0.31
18 0.35
19 0.37
20 0.36
21 0.44
22 0.51
23 0.56
24 0.58
25 0.57
26 0.59
27 0.64
28 0.68
29 0.68
30 0.67
31 0.69
32 0.7
33 0.71
34 0.7
35 0.7
36 0.68
37 0.62
38 0.57
39 0.52
40 0.49
41 0.44
42 0.38
43 0.29
44 0.23
45 0.24
46 0.25
47 0.24
48 0.23
49 0.22
50 0.2
51 0.21
52 0.22
53 0.19
54 0.15
55 0.14
56 0.17
57 0.17
58 0.19
59 0.17
60 0.18
61 0.2
62 0.19
63 0.21
64 0.2
65 0.2
66 0.18
67 0.2
68 0.18
69 0.14
70 0.14
71 0.11
72 0.09
73 0.1
74 0.1
75 0.11
76 0.14
77 0.13
78 0.12
79 0.13
80 0.13
81 0.12
82 0.14
83 0.15
84 0.14
85 0.14
86 0.14
87 0.14
88 0.14
89 0.14
90 0.12
91 0.08
92 0.06
93 0.08
94 0.09
95 0.08
96 0.09
97 0.1
98 0.11
99 0.13
100 0.13
101 0.12
102 0.12
103 0.13
104 0.13
105 0.12
106 0.12
107 0.11
108 0.11
109 0.1
110 0.09
111 0.09
112 0.09
113 0.09
114 0.09
115 0.08
116 0.08
117 0.09
118 0.09
119 0.09
120 0.09
121 0.08
122 0.08
123 0.07
124 0.08
125 0.08
126 0.08
127 0.08
128 0.13
129 0.13
130 0.14
131 0.15
132 0.14
133 0.14
134 0.15
135 0.16
136 0.13
137 0.13
138 0.12
139 0.12
140 0.11
141 0.11
142 0.1
143 0.08
144 0.06
145 0.05
146 0.05
147 0.05
148 0.05
149 0.09
150 0.1
151 0.12
152 0.13
153 0.14
154 0.15
155 0.17
156 0.18
157 0.16
158 0.17
159 0.19
160 0.18
161 0.18
162 0.17
163 0.17
164 0.18
165 0.2
166 0.21
167 0.23
168 0.3
169 0.34
170 0.37
171 0.4
172 0.42
173 0.46
174 0.48
175 0.44
176 0.42
177 0.46
178 0.45
179 0.43
180 0.4
181 0.32
182 0.27
183 0.25
184 0.2
185 0.12
186 0.1
187 0.1
188 0.15
189 0.15
190 0.17
191 0.22
192 0.28
193 0.36
194 0.43
195 0.5
196 0.56
197 0.66
198 0.74
199 0.79
200 0.83
201 0.85
202 0.86
203 0.79
204 0.7
205 0.63
206 0.52
207 0.43
208 0.34
209 0.23
210 0.14
211 0.12
212 0.09
213 0.09
214 0.09
215 0.07
216 0.08
217 0.08
218 0.08
219 0.11
220 0.12
221 0.11
222 0.14
223 0.13
224 0.13
225 0.14
226 0.14
227 0.11
228 0.1
229 0.08
230 0.09
231 0.09
232 0.09
233 0.08
234 0.09
235 0.09
236 0.09
237 0.09
238 0.08
239 0.07
240 0.08
241 0.07
242 0.07
243 0.06
244 0.07
245 0.07
246 0.05
247 0.05
248 0.04
249 0.05
250 0.05
251 0.06
252 0.07
253 0.06
254 0.06
255 0.07
256 0.08
257 0.07
258 0.08
259 0.07
260 0.07
261 0.1
262 0.11
263 0.12
264 0.14
265 0.19
266 0.25
267 0.32
268 0.33
269 0.31
270 0.37
271 0.38
272 0.45
273 0.47
274 0.44
275 0.43
276 0.48
277 0.47
278 0.43
279 0.41