Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JQF4

Protein Details
Accession C4JQF4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-31SQLSPLPRRSRGRPPNSKNRPKGNPASRVEHydrophilic
NLS Segment(s)
PositionSequence
9-24RRSRGRPPNSKNRPKG
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
KEGG ure:UREG_04708  -  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSQLSPLPRRSRGRPPNSKNRPKGNPASRVEVVVRSSSHSSPTYREYICSWNGCNAKLHNFDTLKKHVARVHLPFNSHVTYCQWSGCAEAGNHFVSAVELQEHVDIVHICSLAWKYGEGPATKGSGETGNNVAHPIVIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.84
4 0.89
5 0.93
6 0.91
7 0.9
8 0.87
9 0.85
10 0.86
11 0.83
12 0.82
13 0.75
14 0.73
15 0.64
16 0.58
17 0.51
18 0.43
19 0.36
20 0.28
21 0.25
22 0.2
23 0.23
24 0.21
25 0.23
26 0.22
27 0.22
28 0.23
29 0.26
30 0.28
31 0.25
32 0.26
33 0.25
34 0.27
35 0.29
36 0.28
37 0.25
38 0.26
39 0.28
40 0.27
41 0.27
42 0.24
43 0.26
44 0.28
45 0.29
46 0.28
47 0.28
48 0.31
49 0.33
50 0.35
51 0.34
52 0.3
53 0.32
54 0.28
55 0.31
56 0.32
57 0.31
58 0.34
59 0.31
60 0.32
61 0.3
62 0.31
63 0.28
64 0.23
65 0.2
66 0.16
67 0.16
68 0.16
69 0.15
70 0.13
71 0.11
72 0.13
73 0.12
74 0.12
75 0.09
76 0.11
77 0.13
78 0.13
79 0.13
80 0.11
81 0.11
82 0.09
83 0.09
84 0.08
85 0.06
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.09
95 0.09
96 0.08
97 0.11
98 0.12
99 0.12
100 0.12
101 0.11
102 0.11
103 0.15
104 0.2
105 0.18
106 0.2
107 0.2
108 0.22
109 0.21
110 0.2
111 0.18
112 0.17
113 0.17
114 0.18
115 0.2
116 0.19
117 0.2
118 0.21
119 0.19