Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SUW2

Protein Details
Accession A0A060SUW2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
27-50LGRLDVGHRRRRRFRVRVRVSALCHydrophilic
66-86VGGVGRRRGRRRRGRGGGGEQBasic
NLS Segment(s)
PositionSequence
35-41RRRRRFR
60-83RRARRGVGGVGRRRGRRRRGRGGG
Subcellular Location(s) mito 11, cyto 7, mito_nucl 7
Family & Domain DBs
Amino Acid Sequences GRTRRPDLGRAPAVEPEHAPGLPALGLGRLDVGHRRRRRFRVRVRVSALCSWGALPLYARRARRGVGGVGRRRGRRRRGRGGGGEQAVHDRATAADAVPGASRAPAARAARVRAHGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.35
3 0.28
4 0.24
5 0.21
6 0.19
7 0.14
8 0.13
9 0.11
10 0.1
11 0.08
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.07
18 0.14
19 0.2
20 0.29
21 0.36
22 0.45
23 0.53
24 0.63
25 0.73
26 0.77
27 0.81
28 0.83
29 0.85
30 0.85
31 0.82
32 0.77
33 0.7
34 0.62
35 0.52
36 0.41
37 0.32
38 0.24
39 0.18
40 0.13
41 0.09
42 0.08
43 0.08
44 0.13
45 0.17
46 0.18
47 0.19
48 0.2
49 0.21
50 0.22
51 0.22
52 0.21
53 0.24
54 0.31
55 0.34
56 0.4
57 0.45
58 0.49
59 0.55
60 0.61
61 0.64
62 0.67
63 0.72
64 0.76
65 0.79
66 0.82
67 0.81
68 0.78
69 0.75
70 0.66
71 0.56
72 0.46
73 0.39
74 0.32
75 0.24
76 0.17
77 0.1
78 0.09
79 0.09
80 0.09
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.08
90 0.07
91 0.09
92 0.16
93 0.17
94 0.24
95 0.28
96 0.33
97 0.38
98 0.41