Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060SF81

Protein Details
Accession A0A060SF81    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-31TKQATTDASKKPKPRRKSSSAGGRKKLHydrophilic
NLS Segment(s)
PositionSequence
14-30KKPKPRRKSSSAGGRKK
Subcellular Location(s) nucl 21.5, mito_nucl 13, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
IPR006780  YABBY  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04690  YABBY  
Amino Acid Sequences MVVTTKQATTDASKKPKPRRKSSSAGGRKKLTDFNKFMQTEVARLKQENPDMPHKDRFKLVIDNWNKQKESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.66
3 0.74
4 0.77
5 0.81
6 0.81
7 0.8
8 0.81
9 0.82
10 0.82
11 0.83
12 0.82
13 0.77
14 0.71
15 0.65
16 0.59
17 0.57
18 0.51
19 0.49
20 0.43
21 0.41
22 0.46
23 0.44
24 0.42
25 0.38
26 0.33
27 0.29
28 0.29
29 0.29
30 0.21
31 0.22
32 0.24
33 0.25
34 0.29
35 0.31
36 0.32
37 0.37
38 0.42
39 0.46
40 0.52
41 0.51
42 0.49
43 0.46
44 0.45
45 0.4
46 0.42
47 0.42
48 0.43
49 0.47
50 0.54
51 0.6
52 0.64