Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060S9X5

Protein Details
Accession A0A060S9X5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-111NTKGQEYQPSQRKRKRKHGFLSRKRSVDGHydrophilic
NLS Segment(s)
PositionSequence
94-123RKRKRKHGFLSRKRSVDGRKTLARRRAKGR
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSIARLLIRPPPLPAATALPRAATSSTSFISSVTPLRQFLPSTASSTSLLPLGSLLSRLNPDFSVPSLFTPVLQVRHNTKGQEYQPSQRKRKRKHGFLSRKRSVDGRKTLARRRAKGRLYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.34
4 0.33
5 0.31
6 0.27
7 0.27
8 0.26
9 0.29
10 0.27
11 0.23
12 0.22
13 0.23
14 0.22
15 0.17
16 0.15
17 0.14
18 0.14
19 0.15
20 0.15
21 0.14
22 0.14
23 0.14
24 0.14
25 0.14
26 0.15
27 0.15
28 0.16
29 0.18
30 0.18
31 0.17
32 0.19
33 0.17
34 0.18
35 0.17
36 0.18
37 0.17
38 0.17
39 0.16
40 0.12
41 0.11
42 0.08
43 0.08
44 0.06
45 0.05
46 0.06
47 0.05
48 0.05
49 0.07
50 0.07
51 0.08
52 0.07
53 0.08
54 0.08
55 0.08
56 0.1
57 0.09
58 0.1
59 0.11
60 0.11
61 0.1
62 0.13
63 0.14
64 0.15
65 0.15
66 0.18
67 0.2
68 0.26
69 0.28
70 0.26
71 0.26
72 0.31
73 0.32
74 0.39
75 0.38
76 0.42
77 0.49
78 0.58
79 0.66
80 0.67
81 0.75
82 0.75
83 0.83
84 0.84
85 0.86
86 0.87
87 0.88
88 0.91
89 0.92
90 0.93
91 0.9
92 0.83
93 0.74
94 0.71
95 0.69
96 0.67
97 0.65
98 0.62
99 0.62
100 0.68
101 0.75
102 0.77
103 0.78
104 0.76
105 0.76
106 0.78
107 0.75
108 0.76