Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060S3E8

Protein Details
Accession A0A060S3E8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-135LEPRAKKSKAQAKASKKPTKKANKKASAKVSAKHydrophilic
NLS Segment(s)
PositionSequence
106-139RAKKSKAQAKASKKPTKKANKKASAKVSAKATKA
Subcellular Location(s) extr 23, mito 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036908  RlpA-like_sf  
CDD cd22191  DPBB_RlpA_EXP_N-like  
Amino Acid Sequences MKATSIPLTFVRLGTALILAVSLASLTLIGVSAAEIDTARMALERKYTTPHSLGEGYVFNPRDGWETVNMTDLLYKYSRADSDSDMADQDGEDDSDDPGVSVLEPRAKKSKAQAKASKKPTKKANKKASAKVSAKATKATTKKLASTAGGVLSGGLSKVVNSIKGIAYVPLPIHRYTGHDLLNPSCWDNTDWHPTDASFAAALTLDGWATKPKCFKFLELCHSAQKCAFVRVVDSCAGCAKGSKHVDLTKAAFSTLANLEEGLLTVQMRQATDPEDGWLENLWGPKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.09
4 0.08
5 0.07
6 0.05
7 0.05
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.04
23 0.05
24 0.05
25 0.05
26 0.05
27 0.06
28 0.07
29 0.09
30 0.15
31 0.17
32 0.18
33 0.23
34 0.27
35 0.31
36 0.33
37 0.32
38 0.31
39 0.3
40 0.29
41 0.25
42 0.23
43 0.19
44 0.23
45 0.23
46 0.18
47 0.17
48 0.18
49 0.19
50 0.19
51 0.2
52 0.17
53 0.19
54 0.19
55 0.21
56 0.21
57 0.17
58 0.18
59 0.16
60 0.15
61 0.13
62 0.13
63 0.12
64 0.14
65 0.15
66 0.14
67 0.16
68 0.16
69 0.18
70 0.18
71 0.17
72 0.16
73 0.15
74 0.13
75 0.11
76 0.09
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.06
90 0.12
91 0.13
92 0.16
93 0.23
94 0.24
95 0.26
96 0.34
97 0.41
98 0.44
99 0.54
100 0.6
101 0.63
102 0.72
103 0.8
104 0.81
105 0.76
106 0.74
107 0.75
108 0.77
109 0.77
110 0.78
111 0.79
112 0.8
113 0.83
114 0.84
115 0.82
116 0.8
117 0.72
118 0.64
119 0.61
120 0.55
121 0.49
122 0.43
123 0.37
124 0.35
125 0.35
126 0.35
127 0.34
128 0.3
129 0.31
130 0.3
131 0.3
132 0.23
133 0.22
134 0.19
135 0.13
136 0.11
137 0.1
138 0.07
139 0.06
140 0.05
141 0.04
142 0.03
143 0.03
144 0.03
145 0.06
146 0.06
147 0.07
148 0.07
149 0.09
150 0.09
151 0.1
152 0.1
153 0.08
154 0.09
155 0.09
156 0.09
157 0.11
158 0.13
159 0.12
160 0.13
161 0.13
162 0.17
163 0.19
164 0.23
165 0.21
166 0.22
167 0.23
168 0.23
169 0.26
170 0.23
171 0.2
172 0.16
173 0.16
174 0.15
175 0.16
176 0.19
177 0.24
178 0.26
179 0.25
180 0.26
181 0.25
182 0.26
183 0.23
184 0.19
185 0.1
186 0.08
187 0.07
188 0.07
189 0.07
190 0.05
191 0.04
192 0.04
193 0.04
194 0.05
195 0.1
196 0.12
197 0.15
198 0.22
199 0.23
200 0.29
201 0.31
202 0.35
203 0.39
204 0.45
205 0.5
206 0.49
207 0.51
208 0.52
209 0.52
210 0.48
211 0.4
212 0.39
213 0.32
214 0.3
215 0.29
216 0.21
217 0.23
218 0.24
219 0.26
220 0.22
221 0.21
222 0.19
223 0.19
224 0.19
225 0.16
226 0.17
227 0.16
228 0.22
229 0.25
230 0.27
231 0.31
232 0.33
233 0.36
234 0.38
235 0.4
236 0.35
237 0.32
238 0.29
239 0.24
240 0.2
241 0.22
242 0.19
243 0.17
244 0.13
245 0.13
246 0.13
247 0.13
248 0.13
249 0.09
250 0.07
251 0.06
252 0.07
253 0.09
254 0.11
255 0.11
256 0.12
257 0.13
258 0.15
259 0.18
260 0.18
261 0.17
262 0.18
263 0.17
264 0.18
265 0.17
266 0.15
267 0.15