Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060SK60

Protein Details
Accession A0A060SK60    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
104-129PSEESAKGTTRKKRKRLRRSPPFNALHydrophilic
NLS Segment(s)
PositionSequence
110-124KGTTRKKRKRLRRSP
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MTIRRSRRKTTGDDDPPPRPANKFILFRLAKCKEMEQASEALCGGTLQQRHLSVDLGEAWNALPVDEKNRKRMHSCRSISVGTRITSPLQTGRSAGGGWSSRLPSEESAKGTTRKKRKRLRRSPPFNAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.68
3 0.67
4 0.62
5 0.56
6 0.48
7 0.43
8 0.42
9 0.43
10 0.43
11 0.39
12 0.47
13 0.46
14 0.45
15 0.51
16 0.46
17 0.41
18 0.38
19 0.38
20 0.34
21 0.35
22 0.34
23 0.26
24 0.26
25 0.23
26 0.22
27 0.2
28 0.14
29 0.12
30 0.1
31 0.08
32 0.09
33 0.09
34 0.1
35 0.12
36 0.13
37 0.14
38 0.15
39 0.15
40 0.11
41 0.12
42 0.12
43 0.1
44 0.09
45 0.08
46 0.07
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.12
53 0.21
54 0.22
55 0.29
56 0.33
57 0.35
58 0.4
59 0.47
60 0.49
61 0.51
62 0.52
63 0.49
64 0.5
65 0.5
66 0.46
67 0.44
68 0.39
69 0.29
70 0.27
71 0.24
72 0.21
73 0.2
74 0.19
75 0.18
76 0.16
77 0.16
78 0.16
79 0.15
80 0.15
81 0.14
82 0.13
83 0.14
84 0.13
85 0.14
86 0.16
87 0.16
88 0.15
89 0.16
90 0.19
91 0.17
92 0.21
93 0.23
94 0.24
95 0.27
96 0.31
97 0.36
98 0.42
99 0.49
100 0.55
101 0.61
102 0.69
103 0.76
104 0.83
105 0.88
106 0.92
107 0.94
108 0.94
109 0.94