A0A060ST07

UniProt ID: A0A060ST07   Organism: Pycnoporus cinnabarinus
Gene: BN946_scf184858.g48   Protein: Uncharacterized protein
Length: 134 AA

Protein Details

• Accession: A0A060ST07
• Localization Confidence: High
• Confidence Score: 17.2
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  65-108	PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKYAVKA	Hydrophilic

• NLS Segment(s):

  Position	Sequence
  59-104	KKKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKY

• Subcellular Location(s): nucl 24, mito 2
• Family & Domain DBs:
  • InterPro:
    • IPR001854 Ribosomal_L29/L35
    • IPR036049 Ribosomal_L29/L35_sf
    • IPR045059 RL35
  • Gene Ontology:
    • GO:0022625 C:cytosolic large ribosomal subunit
    • GO:0003735 F:structural constituent of ribosome
    • GO:0000463 P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
    • GO:0006412 P:translation
  • Pfam:
    • PF00831 Ribosomal_L29
• Amino Acid Sequences: MPGKVKAYELQSKSKNDLSNQLKELKTELLNLRVQKIAGGSAAKLTKMYVQANLREFYKKKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKYAVKAA

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.55
2, 0.53
3, 0.46
4, 0.52
5, 0.49
6, 0.5
7, 0.49
8, 0.51
9, 0.46
10, 0.42
11, 0.42
12, 0.36
13, 0.3
14, 0.28
15, 0.27
16, 0.25
17, 0.29
18, 0.29
19, 0.29
20, 0.26
21, 0.25
22, 0.2
23, 0.18
24, 0.14
25, 0.11
26, 0.11
27, 0.09
28, 0.11
29, 0.12
30, 0.11
31, 0.11
32, 0.1
33, 0.11
34, 0.14
35, 0.15
36, 0.16
37, 0.18
38, 0.22
39, 0.24
40, 0.25
41, 0.24
42, 0.25
43, 0.25
44, 0.28
45, 0.36
46, 0.37
47, 0.38
48, 0.45
49, 0.49
50, 0.55
51, 0.64
52, 0.66
53, 0.68
54, 0.71
55, 0.77
56, 0.73
57, 0.7
58, 0.67
59, 0.66
60, 0.66
61, 0.65
62, 0.67
63, 0.68
64, 0.75
65, 0.82
66, 0.84
67, 0.83
68, 0.78
69, 0.77
70, 0.76
71, 0.7
72, 0.66
73, 0.64
74, 0.61
75, 0.63
76, 0.65
77, 0.62
78, 0.6
79, 0.67
80, 0.7
81, 0.71
82, 0.76
83, 0.77
84, 0.8
85, 0.85
86, 0.83
87, 0.83
88, 0.84
89, 0.8