Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060ST07

Protein Details
Accession A0A060ST07   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-108PLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKYAVKAHydrophilic
NLS Segment(s)
PositionSequence
59-104KKKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKY
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSNQLKELKTELLNLRVQKIAGGSAAKLTKMYVQANLREFYKKKKYLPLDLRPKKTRAIRRRLTKHEASLKTLKQRKKDIHFPPRKYAVKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.53
3 0.46
4 0.52
5 0.49
6 0.5
7 0.49
8 0.51
9 0.46
10 0.42
11 0.42
12 0.36
13 0.3
14 0.28
15 0.27
16 0.25
17 0.29
18 0.29
19 0.29
20 0.26
21 0.25
22 0.2
23 0.18
24 0.14
25 0.11
26 0.11
27 0.09
28 0.11
29 0.12
30 0.11
31 0.11
32 0.1
33 0.11
34 0.14
35 0.15
36 0.16
37 0.18
38 0.22
39 0.24
40 0.25
41 0.24
42 0.25
43 0.25
44 0.28
45 0.36
46 0.37
47 0.38
48 0.45
49 0.49
50 0.55
51 0.64
52 0.66
53 0.68
54 0.71
55 0.77
56 0.73
57 0.7
58 0.67
59 0.66
60 0.66
61 0.65
62 0.67
63 0.68
64 0.75
65 0.82
66 0.84
67 0.83
68 0.78
69 0.77
70 0.76
71 0.7
72 0.66
73 0.64
74 0.61
75 0.63
76 0.65
77 0.62
78 0.6
79 0.67
80 0.7
81 0.71
82 0.76
83 0.77
84 0.8
85 0.85
86 0.83
87 0.83
88 0.84
89 0.8