Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SPU0

Protein Details
Accession A0A060SPU0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
41-60ITCFKCTKKGHYQRDCPQLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, pero 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences VIKRLVNEDGPCRCLPFPPPRAPDDVALAAITKPRTPIERITCFKCTKKGHYQRDCPQLNETASAAIDDSVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.37
4 0.41
5 0.45
6 0.49
7 0.48
8 0.52
9 0.52
10 0.46
11 0.4
12 0.33
13 0.24
14 0.2
15 0.18
16 0.13
17 0.13
18 0.12
19 0.09
20 0.09
21 0.1
22 0.12
23 0.14
24 0.21
25 0.27
26 0.34
27 0.38
28 0.41
29 0.46
30 0.48
31 0.48
32 0.5
33 0.47
34 0.47
35 0.55
36 0.61
37 0.66
38 0.71
39 0.79
40 0.79
41 0.84
42 0.8
43 0.71
44 0.64
45 0.58
46 0.5
47 0.42
48 0.34
49 0.25
50 0.22
51 0.2
52 0.16
53 0.1