Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060S2M9

Protein Details
Accession A0A060S2M9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
34-54LNASKRKKPYNIKSSKRNKVDHydrophilic
NLS Segment(s)
PositionSequence
39-42RKKP
Subcellular Location(s) nucl 19.5, mito_nucl 14, mito 7.5
Family & Domain DBs
Amino Acid Sequences MGRHIPAPHKSLVKATGGNMEGFTTIDMRQKQVLNASKRKKPYNIKSSKRNKVDLENNKNGNKDQVPTDLPLQLATRLIISLIAPSTEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.31
4 0.28
5 0.27
6 0.23
7 0.2
8 0.16
9 0.14
10 0.13
11 0.09
12 0.08
13 0.13
14 0.14
15 0.15
16 0.18
17 0.19
18 0.2
19 0.26
20 0.33
21 0.35
22 0.44
23 0.49
24 0.51
25 0.56
26 0.6
27 0.6
28 0.63
29 0.65
30 0.67
31 0.71
32 0.72
33 0.77
34 0.83
35 0.84
36 0.78
37 0.74
38 0.66
39 0.64
40 0.67
41 0.67
42 0.66
43 0.65
44 0.65
45 0.62
46 0.61
47 0.53
48 0.48
49 0.39
50 0.32
51 0.27
52 0.26
53 0.25
54 0.26
55 0.28
56 0.24
57 0.22
58 0.22
59 0.2
60 0.16
61 0.15
62 0.13
63 0.11
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09