Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SM38

Protein Details
Accession A0A060SM38    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
239-264YFVGKTKSSAPKPKPKKEDKIYIEIDHydrophilic
NLS Segment(s)
PositionSequence
41-104TQKSRGGPASRGGRYYQRGGKSAPRDKENGEAAAEDSEPKKRDGEGRGRGRGRGRGDRARGRGR
245-259KSSAPKPKPKKEDKI
264-300DARFERPSRGGRGRGDRGGDRPPRGGGGRGRGGRGRA
Subcellular Location(s) cyto_nucl 14.5, nucl 14, cyto 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF04774  HABP4_PAI-RBP1  
Amino Acid Sequences MSVASRNPFALLDEDASRPASPSPATPAKEAAPAPAPTRGTQKSRGGPASRGGRYYQRGGKSAPRDKENGEAAAEDSEPKKRDGEGRGRGRGRGRGDRARGRGRQFDRHSATGKTDSEKKVHQGWGGDEPTSELNAETGAATDAAAEKNEWTNSGEGDAWAAAAADTGDAAASGEKAEGRKPREPREPEEEDNTLTLDEYLKKKQSLDIVPKPEVRKVDDSDLKDAVIITKKDEDEDAYFVGKTKSSAPKPKPKKEDKIYIEIDARFERPSRGGRGRGDRGGDRPPRGGGGRGRGGRGRAANGNNSAPALNVADEAAFPSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.19
5 0.18
6 0.16
7 0.17
8 0.15
9 0.16
10 0.23
11 0.3
12 0.32
13 0.32
14 0.35
15 0.33
16 0.37
17 0.35
18 0.31
19 0.29
20 0.29
21 0.29
22 0.32
23 0.32
24 0.29
25 0.37
26 0.39
27 0.39
28 0.44
29 0.5
30 0.51
31 0.57
32 0.63
33 0.58
34 0.55
35 0.58
36 0.59
37 0.53
38 0.48
39 0.44
40 0.44
41 0.45
42 0.49
43 0.48
44 0.43
45 0.44
46 0.45
47 0.51
48 0.53
49 0.58
50 0.57
51 0.54
52 0.53
53 0.52
54 0.55
55 0.5
56 0.41
57 0.33
58 0.27
59 0.23
60 0.22
61 0.2
62 0.15
63 0.13
64 0.17
65 0.18
66 0.18
67 0.19
68 0.19
69 0.26
70 0.32
71 0.41
72 0.46
73 0.53
74 0.61
75 0.61
76 0.64
77 0.62
78 0.6
79 0.57
80 0.56
81 0.55
82 0.55
83 0.61
84 0.64
85 0.68
86 0.7
87 0.69
88 0.64
89 0.66
90 0.63
91 0.65
92 0.62
93 0.64
94 0.6
95 0.58
96 0.56
97 0.48
98 0.46
99 0.41
100 0.38
101 0.32
102 0.33
103 0.32
104 0.32
105 0.32
106 0.32
107 0.33
108 0.34
109 0.33
110 0.27
111 0.27
112 0.31
113 0.3
114 0.26
115 0.21
116 0.19
117 0.18
118 0.16
119 0.14
120 0.07
121 0.06
122 0.06
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.07
136 0.07
137 0.08
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.07
144 0.07
145 0.06
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.04
163 0.05
164 0.09
165 0.14
166 0.2
167 0.26
168 0.32
169 0.39
170 0.48
171 0.53
172 0.54
173 0.57
174 0.59
175 0.55
176 0.54
177 0.48
178 0.38
179 0.34
180 0.29
181 0.2
182 0.13
183 0.11
184 0.08
185 0.1
186 0.13
187 0.16
188 0.19
189 0.2
190 0.21
191 0.23
192 0.29
193 0.33
194 0.4
195 0.43
196 0.46
197 0.49
198 0.53
199 0.52
200 0.48
201 0.43
202 0.38
203 0.36
204 0.33
205 0.38
206 0.39
207 0.4
208 0.41
209 0.39
210 0.34
211 0.29
212 0.26
213 0.21
214 0.2
215 0.18
216 0.16
217 0.2
218 0.2
219 0.21
220 0.21
221 0.21
222 0.17
223 0.19
224 0.18
225 0.15
226 0.15
227 0.15
228 0.15
229 0.13
230 0.12
231 0.17
232 0.25
233 0.32
234 0.42
235 0.5
236 0.6
237 0.71
238 0.8
239 0.83
240 0.84
241 0.87
242 0.86
243 0.88
244 0.83
245 0.81
246 0.74
247 0.68
248 0.63
249 0.53
250 0.48
251 0.39
252 0.34
253 0.27
254 0.25
255 0.23
256 0.23
257 0.27
258 0.32
259 0.37
260 0.43
261 0.49
262 0.57
263 0.61
264 0.61
265 0.61
266 0.56
267 0.53
268 0.57
269 0.56
270 0.51
271 0.47
272 0.43
273 0.42
274 0.41
275 0.42
276 0.39
277 0.4
278 0.45
279 0.45
280 0.48
281 0.47
282 0.47
283 0.47
284 0.45
285 0.41
286 0.4
287 0.42
288 0.44
289 0.45
290 0.45
291 0.39
292 0.37
293 0.32
294 0.25
295 0.22
296 0.17
297 0.13
298 0.11
299 0.11
300 0.1
301 0.1
302 0.11