Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SJ58

Protein Details
Accession A0A060SJ58    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MEQPKRRRGHLPKKKRENLLQNLQSAHydrophilic
NLS Segment(s)
PositionSequence
5-16KRRRGHLPKKKR
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MEQPKRRRGHLPKKKRENLLQNLQSAHKIEEEVGGEAGGVSPSEEETEELAAGPLGLWDPHASLKPSQLDGATSDGEVDIEGPLAEEEVLRQRELLIEMLEDVNEDNPRDRDWLPVLEAKKLWEKASTGESLCSLVWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.91
3 0.9
4 0.89
5 0.87
6 0.87
7 0.81
8 0.73
9 0.67
10 0.59
11 0.52
12 0.43
13 0.34
14 0.24
15 0.19
16 0.16
17 0.16
18 0.16
19 0.14
20 0.13
21 0.11
22 0.1
23 0.09
24 0.09
25 0.06
26 0.04
27 0.03
28 0.03
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.05
47 0.06
48 0.07
49 0.09
50 0.09
51 0.13
52 0.14
53 0.14
54 0.14
55 0.13
56 0.12
57 0.12
58 0.13
59 0.1
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.05
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.1
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.14
82 0.14
83 0.08
84 0.08
85 0.09
86 0.09
87 0.08
88 0.07
89 0.07
90 0.07
91 0.08
92 0.09
93 0.11
94 0.12
95 0.14
96 0.17
97 0.17
98 0.2
99 0.22
100 0.24
101 0.24
102 0.29
103 0.29
104 0.3
105 0.3
106 0.29
107 0.34
108 0.34
109 0.32
110 0.29
111 0.29
112 0.29
113 0.33
114 0.34
115 0.27
116 0.26
117 0.25
118 0.23