Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JKM7

Protein Details
Accession C4JKM7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-54LLSRTRVPRRGRERKRGWSAARRBasic
NLS Segment(s)
PositionSequence
36-53TRVPRRGRERKRGWSAAR
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5
Family & Domain DBs
KEGG ure:UREG_00324  -  
Amino Acid Sequences MAPDTMQRYMERRSHERKVRSLAQWSRQSEALLSRTRVPRRGRERKRGWSAARRWLQLERLAVSKMKGFLEGVKWGEWWWKVPGEVHWLNVEGIRQRVIGVAEDIVFDIGARFSRHDGAFHSLSVHSGGEQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.69
4 0.69
5 0.73
6 0.73
7 0.69
8 0.71
9 0.69
10 0.69
11 0.7
12 0.65
13 0.6
14 0.53
15 0.48
16 0.39
17 0.36
18 0.32
19 0.27
20 0.27
21 0.31
22 0.37
23 0.4
24 0.46
25 0.47
26 0.51
27 0.58
28 0.68
29 0.71
30 0.74
31 0.8
32 0.83
33 0.86
34 0.85
35 0.81
36 0.8
37 0.76
38 0.75
39 0.7
40 0.61
41 0.55
42 0.48
43 0.44
44 0.37
45 0.33
46 0.25
47 0.21
48 0.2
49 0.19
50 0.17
51 0.16
52 0.14
53 0.12
54 0.11
55 0.1
56 0.1
57 0.11
58 0.14
59 0.13
60 0.12
61 0.12
62 0.12
63 0.15
64 0.14
65 0.14
66 0.14
67 0.14
68 0.14
69 0.15
70 0.17
71 0.21
72 0.21
73 0.21
74 0.19
75 0.19
76 0.19
77 0.19
78 0.19
79 0.13
80 0.13
81 0.13
82 0.12
83 0.11
84 0.12
85 0.12
86 0.11
87 0.1
88 0.1
89 0.09
90 0.09
91 0.09
92 0.08
93 0.07
94 0.06
95 0.05
96 0.05
97 0.07
98 0.08
99 0.09
100 0.11
101 0.17
102 0.18
103 0.19
104 0.22
105 0.27
106 0.27
107 0.26
108 0.26
109 0.21
110 0.21
111 0.21
112 0.18