Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SUA0

Protein Details
Accession A0A060SUA0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-62QSAPATPTPRPLRQRPRPFPNSYWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR026893  Tyr/Ser_Pase_IphP-type  
IPR016130  Tyr_Pase_AS  
IPR000387  Tyr_Pase_dom  
Gene Ontology GO:0004721  F:phosphoprotein phosphatase activity  
GO:0016311  P:dephosphorylation  
Pfam View protein in Pfam  
PF13350  Y_phosphatase3  
PROSITE View protein in PROSITE  
PS00383  TYR_PHOSPHATASE_1  
PS50056  TYR_PHOSPHATASE_2  
Amino Acid Sequences MAVATREMTHLDQLPAGMSSSSSSSIRRDRFSLNMSRTQSAPATPTPRPLRQRPRPFPNSYWATPYLIACEFPFCPLTPTQIERKNTKQKLDTLLSAGVRTFIDLTEPHELFPYWPHLAQRCYDLGIDPREVEYHNFPIRDRSLPESVEFVRRIMDVLRDNENRGRVAAVHCRGGIGRTGLIVGCWLVECGIARNGDDALRMIAEEWKNVEKCKRYPSSPETGPQHEYVRTFERAAWIDEKHQVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.16
4 0.12
5 0.09
6 0.09
7 0.1
8 0.12
9 0.13
10 0.14
11 0.19
12 0.28
13 0.33
14 0.35
15 0.37
16 0.38
17 0.43
18 0.47
19 0.5
20 0.47
21 0.5
22 0.51
23 0.49
24 0.46
25 0.43
26 0.38
27 0.3
28 0.28
29 0.26
30 0.28
31 0.27
32 0.36
33 0.4
34 0.47
35 0.53
36 0.6
37 0.65
38 0.7
39 0.8
40 0.81
41 0.85
42 0.85
43 0.85
44 0.78
45 0.76
46 0.72
47 0.62
48 0.57
49 0.49
50 0.42
51 0.37
52 0.33
53 0.27
54 0.21
55 0.2
56 0.14
57 0.15
58 0.13
59 0.13
60 0.14
61 0.11
62 0.13
63 0.13
64 0.17
65 0.18
66 0.21
67 0.27
68 0.33
69 0.36
70 0.39
71 0.48
72 0.55
73 0.56
74 0.59
75 0.55
76 0.53
77 0.56
78 0.54
79 0.46
80 0.37
81 0.36
82 0.3
83 0.26
84 0.21
85 0.15
86 0.12
87 0.11
88 0.09
89 0.05
90 0.07
91 0.07
92 0.1
93 0.14
94 0.14
95 0.14
96 0.15
97 0.15
98 0.14
99 0.15
100 0.16
101 0.12
102 0.13
103 0.14
104 0.17
105 0.18
106 0.18
107 0.19
108 0.15
109 0.15
110 0.14
111 0.14
112 0.14
113 0.15
114 0.15
115 0.12
116 0.12
117 0.12
118 0.12
119 0.13
120 0.12
121 0.16
122 0.18
123 0.18
124 0.18
125 0.22
126 0.24
127 0.24
128 0.23
129 0.23
130 0.23
131 0.24
132 0.24
133 0.23
134 0.22
135 0.25
136 0.23
137 0.18
138 0.16
139 0.15
140 0.15
141 0.13
142 0.16
143 0.15
144 0.17
145 0.24
146 0.25
147 0.27
148 0.3
149 0.31
150 0.27
151 0.23
152 0.21
153 0.15
154 0.18
155 0.24
156 0.23
157 0.24
158 0.23
159 0.23
160 0.23
161 0.22
162 0.2
163 0.13
164 0.11
165 0.09
166 0.1
167 0.09
168 0.09
169 0.08
170 0.06
171 0.05
172 0.05
173 0.05
174 0.04
175 0.05
176 0.05
177 0.07
178 0.1
179 0.11
180 0.11
181 0.12
182 0.12
183 0.12
184 0.12
185 0.11
186 0.09
187 0.08
188 0.08
189 0.08
190 0.14
191 0.14
192 0.15
193 0.17
194 0.23
195 0.25
196 0.29
197 0.36
198 0.37
199 0.41
200 0.5
201 0.54
202 0.52
203 0.6
204 0.63
205 0.65
206 0.62
207 0.65
208 0.62
209 0.6
210 0.59
211 0.53
212 0.5
213 0.44
214 0.41
215 0.37
216 0.36
217 0.34
218 0.32
219 0.3
220 0.33
221 0.32
222 0.35
223 0.34
224 0.31
225 0.32