Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SA33

Protein Details
Accession A0A060SA33    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
326-347LSKANPKLRRAWVRRVVNERYSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045026  LIMYB  
Amino Acid Sequences MSRGKGSKVSAGGSRSASVSTSTQDTAGAAKENAKWTLEDEKAFVGYLTDHVSERGDGNYKMTTFNAAAAYLEGRRTAGGPKTGTGCKNNGLGCIKETYMVCYKLKQNHGTSGFTWSEEKGADIGIEDEPIWEAYIKKNPKADHFKNKGWPLYDAVDRIIPDKVKGKNLFAASQAPVPNPQSSDNPEGNTSETDGADEEASQDPADVYIPPPAPPAPPSGRKRSALEAENSVSTPSPSGSFTTRRPPRDTAVSRSIDRMSEVLAVIAGPTSGAPTDVSLESTPKRRRIAVELAAKQEDEELSEDDMVELVEVMRRDISAADTYLSLSKANPKLRRAWVRRVVNERYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.27
3 0.24
4 0.22
5 0.19
6 0.18
7 0.17
8 0.18
9 0.18
10 0.17
11 0.17
12 0.17
13 0.15
14 0.16
15 0.16
16 0.13
17 0.16
18 0.2
19 0.24
20 0.25
21 0.24
22 0.23
23 0.24
24 0.31
25 0.31
26 0.28
27 0.25
28 0.25
29 0.24
30 0.24
31 0.2
32 0.13
33 0.1
34 0.11
35 0.12
36 0.12
37 0.12
38 0.13
39 0.14
40 0.14
41 0.15
42 0.16
43 0.17
44 0.16
45 0.18
46 0.21
47 0.2
48 0.21
49 0.2
50 0.2
51 0.17
52 0.19
53 0.17
54 0.14
55 0.13
56 0.13
57 0.14
58 0.12
59 0.12
60 0.1
61 0.09
62 0.09
63 0.1
64 0.14
65 0.16
66 0.21
67 0.21
68 0.23
69 0.27
70 0.32
71 0.34
72 0.34
73 0.32
74 0.3
75 0.33
76 0.32
77 0.33
78 0.31
79 0.28
80 0.26
81 0.26
82 0.23
83 0.21
84 0.21
85 0.2
86 0.22
87 0.25
88 0.24
89 0.26
90 0.32
91 0.36
92 0.43
93 0.45
94 0.43
95 0.47
96 0.5
97 0.49
98 0.43
99 0.42
100 0.36
101 0.3
102 0.28
103 0.2
104 0.18
105 0.15
106 0.15
107 0.09
108 0.08
109 0.07
110 0.06
111 0.07
112 0.06
113 0.06
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.05
120 0.06
121 0.09
122 0.17
123 0.2
124 0.22
125 0.27
126 0.28
127 0.37
128 0.47
129 0.52
130 0.55
131 0.59
132 0.61
133 0.64
134 0.67
135 0.61
136 0.52
137 0.46
138 0.38
139 0.33
140 0.3
141 0.23
142 0.19
143 0.17
144 0.16
145 0.15
146 0.14
147 0.12
148 0.11
149 0.17
150 0.18
151 0.24
152 0.26
153 0.26
154 0.29
155 0.3
156 0.3
157 0.25
158 0.25
159 0.19
160 0.21
161 0.2
162 0.15
163 0.16
164 0.17
165 0.16
166 0.15
167 0.16
168 0.15
169 0.19
170 0.24
171 0.23
172 0.22
173 0.22
174 0.22
175 0.21
176 0.19
177 0.16
178 0.11
179 0.1
180 0.09
181 0.08
182 0.08
183 0.07
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.06
191 0.06
192 0.07
193 0.05
194 0.05
195 0.09
196 0.1
197 0.1
198 0.12
199 0.12
200 0.13
201 0.14
202 0.19
203 0.2
204 0.29
205 0.34
206 0.41
207 0.46
208 0.48
209 0.5
210 0.5
211 0.51
212 0.45
213 0.43
214 0.38
215 0.34
216 0.32
217 0.29
218 0.24
219 0.18
220 0.14
221 0.12
222 0.08
223 0.08
224 0.08
225 0.1
226 0.13
227 0.17
228 0.2
229 0.31
230 0.38
231 0.42
232 0.46
233 0.48
234 0.49
235 0.55
236 0.57
237 0.54
238 0.55
239 0.54
240 0.5
241 0.49
242 0.45
243 0.35
244 0.31
245 0.24
246 0.17
247 0.14
248 0.13
249 0.1
250 0.09
251 0.08
252 0.07
253 0.06
254 0.05
255 0.03
256 0.03
257 0.04
258 0.04
259 0.04
260 0.05
261 0.05
262 0.09
263 0.09
264 0.11
265 0.11
266 0.15
267 0.18
268 0.27
269 0.34
270 0.37
271 0.41
272 0.42
273 0.46
274 0.49
275 0.55
276 0.54
277 0.58
278 0.56
279 0.57
280 0.55
281 0.5
282 0.43
283 0.36
284 0.27
285 0.18
286 0.16
287 0.13
288 0.13
289 0.14
290 0.14
291 0.12
292 0.12
293 0.1
294 0.07
295 0.06
296 0.04
297 0.07
298 0.07
299 0.08
300 0.08
301 0.08
302 0.09
303 0.1
304 0.13
305 0.12
306 0.13
307 0.13
308 0.13
309 0.15
310 0.16
311 0.16
312 0.14
313 0.13
314 0.21
315 0.28
316 0.37
317 0.43
318 0.46
319 0.54
320 0.64
321 0.74
322 0.72
323 0.75
324 0.76
325 0.79
326 0.84
327 0.83