Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060S9M5

Protein Details
Accession A0A060S9M5    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-34PTVRSYKEWRRRAYDEKKSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 5.5, cyto_nucl 5.5, cyto 4.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003721  Pantoate_ligase  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0004592  F:pantoate-beta-alanine ligase activity  
GO:0015940  P:pantothenate biosynthetic process  
Pfam View protein in Pfam  
PF02569  Pantoate_ligase  
Amino Acid Sequences MSSSDLPQSSIPLFPTVRSYKEWRRRAYDEKKSVGPPFISGERPHRALDIREPAQFAPHEDLATYPRTLPRDLELLSTLSVSGRTAAAVFVPTVDEMYPSGIVQSVDGQKGTFVEVKGYGHQMEGRTRPAFFRGVATVVTKLFNVIEPMRTYFGQKDIQQALLLRRMTRDLLLSHPTPENLFIVPTVRCVTRLRVQPYRYIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.27
3 0.28
4 0.29
5 0.33
6 0.4
7 0.46
8 0.56
9 0.63
10 0.63
11 0.67
12 0.72
13 0.77
14 0.8
15 0.8
16 0.78
17 0.74
18 0.73
19 0.69
20 0.65
21 0.59
22 0.49
23 0.4
24 0.36
25 0.34
26 0.32
27 0.3
28 0.33
29 0.34
30 0.35
31 0.34
32 0.32
33 0.31
34 0.31
35 0.35
36 0.37
37 0.35
38 0.34
39 0.35
40 0.32
41 0.33
42 0.31
43 0.25
44 0.21
45 0.19
46 0.18
47 0.16
48 0.17
49 0.16
50 0.17
51 0.15
52 0.12
53 0.14
54 0.17
55 0.17
56 0.17
57 0.17
58 0.19
59 0.19
60 0.19
61 0.17
62 0.16
63 0.15
64 0.14
65 0.12
66 0.08
67 0.08
68 0.06
69 0.05
70 0.05
71 0.04
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.05
81 0.04
82 0.05
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.08
97 0.09
98 0.1
99 0.09
100 0.08
101 0.09
102 0.1
103 0.11
104 0.12
105 0.13
106 0.11
107 0.1
108 0.12
109 0.13
110 0.16
111 0.18
112 0.21
113 0.21
114 0.21
115 0.21
116 0.22
117 0.22
118 0.18
119 0.18
120 0.15
121 0.15
122 0.15
123 0.16
124 0.14
125 0.13
126 0.14
127 0.11
128 0.1
129 0.09
130 0.09
131 0.11
132 0.11
133 0.13
134 0.14
135 0.17
136 0.19
137 0.19
138 0.21
139 0.19
140 0.23
141 0.25
142 0.25
143 0.3
144 0.29
145 0.3
146 0.29
147 0.3
148 0.29
149 0.3
150 0.3
151 0.24
152 0.23
153 0.24
154 0.24
155 0.23
156 0.22
157 0.18
158 0.21
159 0.26
160 0.25
161 0.26
162 0.27
163 0.26
164 0.24
165 0.24
166 0.21
167 0.16
168 0.16
169 0.13
170 0.15
171 0.14
172 0.16
173 0.17
174 0.16
175 0.18
176 0.2
177 0.26
178 0.31
179 0.4
180 0.46
181 0.52
182 0.54