Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JDE4

Protein Details
Accession C4JDE4   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
118-138DARRNKAAVVEERRRRRRWKSBasic
NLS Segment(s)
PositionSequence
126-138VVEERRRRRRWKS
Subcellular Location(s) mito 16.5, cyto_mito 11, nucl 5, cyto 4.5
Family & Domain DBs
KEGG ure:UREG_00318  -  
Amino Acid Sequences MSRRSFQVRPIGQSSWWIESIAASVPLEKQKFAGIANRTFFCHGGEARHRPAHRFMYASVSFNTAQSAFLLNSRRPGASEGFGHILWYGATKPVAASGGAKRRARTLTATQLQRMNIDARRNKAAVVEERRRRRRWKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.37
3 0.33
4 0.27
5 0.22
6 0.2
7 0.21
8 0.16
9 0.13
10 0.09
11 0.09
12 0.12
13 0.18
14 0.19
15 0.18
16 0.17
17 0.18
18 0.19
19 0.19
20 0.24
21 0.22
22 0.27
23 0.3
24 0.31
25 0.3
26 0.31
27 0.3
28 0.24
29 0.22
30 0.17
31 0.2
32 0.26
33 0.3
34 0.34
35 0.39
36 0.38
37 0.38
38 0.43
39 0.42
40 0.36
41 0.33
42 0.28
43 0.31
44 0.31
45 0.3
46 0.25
47 0.22
48 0.21
49 0.19
50 0.19
51 0.11
52 0.1
53 0.09
54 0.09
55 0.07
56 0.1
57 0.12
58 0.12
59 0.15
60 0.16
61 0.15
62 0.15
63 0.17
64 0.16
65 0.15
66 0.16
67 0.15
68 0.16
69 0.15
70 0.15
71 0.12
72 0.11
73 0.08
74 0.09
75 0.07
76 0.06
77 0.07
78 0.06
79 0.06
80 0.07
81 0.08
82 0.07
83 0.1
84 0.15
85 0.23
86 0.31
87 0.33
88 0.33
89 0.37
90 0.39
91 0.39
92 0.39
93 0.37
94 0.4
95 0.46
96 0.49
97 0.48
98 0.49
99 0.47
100 0.42
101 0.37
102 0.32
103 0.29
104 0.35
105 0.37
106 0.39
107 0.44
108 0.43
109 0.41
110 0.4
111 0.42
112 0.42
113 0.46
114 0.52
115 0.56
116 0.67
117 0.76
118 0.8