Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SM52

Protein Details
Accession A0A060SM52   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSVRRRYRRPFDAQTFRDRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033847  Citrt_syn/SCS-alpha_CS  
IPR003781  CoA-bd  
IPR036291  NAD(P)-bd_dom_sf  
IPR016102  Succinyl-CoA_synth-like  
Pfam View protein in Pfam  
PF02629  CoA_binding  
PROSITE View protein in PROSITE  
PS01216  SUCCINYL_COA_LIG_1  
Amino Acid Sequences MSVRRRYRRPFDAQTFRDRNLGKIRLRPSLKSGRRAFSQSAARQNYEATIRNLLIHKDTKVLCQGLTGKTGTFHVKEALEYGTRMVGGVSPRKAGQTHLGLPVFGSVKEAVREVQPDATVLYVPPPTAADAILEAIENEIGLIVCITEGIPQQDEIKVMNALKRQSKSRLVGPNCPGVINPEGCKMGIQPGAIHTPGRIGIVSRSGTLTYEAVAQTTGVGLGQSLVVGIGGDPSPEPSTSTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.7
4 0.68
5 0.58
6 0.54
7 0.53
8 0.56
9 0.51
10 0.53
11 0.56
12 0.58
13 0.61
14 0.58
15 0.57
16 0.6
17 0.61
18 0.63
19 0.65
20 0.61
21 0.61
22 0.63
23 0.58
24 0.54
25 0.57
26 0.53
27 0.56
28 0.55
29 0.52
30 0.47
31 0.45
32 0.4
33 0.35
34 0.32
35 0.25
36 0.24
37 0.23
38 0.25
39 0.27
40 0.25
41 0.26
42 0.25
43 0.23
44 0.25
45 0.25
46 0.25
47 0.29
48 0.28
49 0.23
50 0.24
51 0.27
52 0.23
53 0.25
54 0.22
55 0.18
56 0.17
57 0.2
58 0.19
59 0.16
60 0.16
61 0.16
62 0.16
63 0.16
64 0.16
65 0.16
66 0.14
67 0.13
68 0.12
69 0.1
70 0.09
71 0.09
72 0.07
73 0.07
74 0.1
75 0.14
76 0.15
77 0.16
78 0.16
79 0.18
80 0.18
81 0.18
82 0.2
83 0.2
84 0.21
85 0.25
86 0.25
87 0.23
88 0.23
89 0.23
90 0.18
91 0.13
92 0.12
93 0.08
94 0.08
95 0.09
96 0.1
97 0.08
98 0.09
99 0.1
100 0.09
101 0.1
102 0.09
103 0.09
104 0.09
105 0.08
106 0.07
107 0.06
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.03
125 0.03
126 0.03
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.03
134 0.04
135 0.05
136 0.06
137 0.06
138 0.07
139 0.08
140 0.09
141 0.1
142 0.09
143 0.1
144 0.11
145 0.11
146 0.14
147 0.16
148 0.2
149 0.25
150 0.28
151 0.31
152 0.35
153 0.42
154 0.42
155 0.47
156 0.53
157 0.51
158 0.56
159 0.55
160 0.55
161 0.48
162 0.45
163 0.37
164 0.31
165 0.3
166 0.24
167 0.22
168 0.19
169 0.19
170 0.19
171 0.19
172 0.16
173 0.18
174 0.18
175 0.17
176 0.14
177 0.16
178 0.19
179 0.2
180 0.19
181 0.14
182 0.14
183 0.14
184 0.14
185 0.12
186 0.1
187 0.11
188 0.16
189 0.17
190 0.16
191 0.17
192 0.16
193 0.17
194 0.18
195 0.16
196 0.11
197 0.14
198 0.13
199 0.12
200 0.11
201 0.1
202 0.08
203 0.08
204 0.08
205 0.05
206 0.04
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.03
214 0.04
215 0.04
216 0.05
217 0.05
218 0.06
219 0.06
220 0.1
221 0.12
222 0.12