FuNGI

C4JNB4

Protein Details

Accession

C4JNB4

Localization Confidence

High

Confidence Score

18.1

NoLS Segment(s)

Position	Sequence	Protein Nature
1-27	MGSESPEKKRKRVSEKHDRPSKKTAVE	Basic

NLS Segment(s)

Position	Sequence
8-23	KKRKRVSEKHDRPSKK
477-508	GIKRGKTEAAMKRIARLRIPVEFPKVSRGGRR

Subcellular Location(s)

nucl 21, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR009668 RNA_pol-assoc_fac_A49-like
Gene Ontology	GO:0000428 C:DNA-directed RNA polymerase complex GO:0005730 C:nucleolus GO:0003677 F:DNA binding GO:0006351 P:DNA-templated transcription
KEGG	ure:UREG_04320 -
Pfam	View protein in Pfam PF06870 RNA_pol_I_A49

Amino Acid Sequences

MGSESPEKKRKRVSEKHDRPSKKTAVESVLPPLKVKFIDNSDGPAPVIGAFKCQIPTAGDTLEEKQIADRIPILASTPGIRLPDSISLSAYTKPRAKRSSKTAATNSGIVSSELLLHSSAHPKFDFTAREGVEQLDSLWNHYVAIYDPKKNSLQLAEARKVTVRSCIRQASPDTEYESEEEEVQTAFSKKSALAEAFGTKQARKAVQSIAENALLSNAPGGAPTAAESALLSSMPKDAISASSAEKTAQQEIQAAKPLPQPNLSASHPSDVYSIDSLIPGGLSTLHSMPVRDWQTALANSEEILTRSRFVAHRIEAVGKTGDKSQLQLLRFILLLIEFAGSLKPTRGADKAGVGSKKIPPREDLRRKLAEATTSKDSSAGGPQFVTDSFIDSLRRKFVPQGAILSRNDLTLLHTTICALTLHVPPASGSPNASNELATDPADIRDDLGLDNKTALQYFRELGCRVDKPRESEFAKWGIKRGKTEAAMKRIARLRIPVEFPKVSRGGRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.83
2	0.89
3	0.92
4	0.92
5	0.9
6	0.85
7	0.84
8	0.82
9	0.77
10	0.72
11	0.68
12	0.64
13	0.61
14	0.57
15	0.56
16	0.54
17	0.47
18	0.43
19	0.37
20	0.34
21	0.31
22	0.31
23	0.27
24	0.27
25	0.32
26	0.32
27	0.36
28	0.33
29	0.33
30	0.31
31	0.24
32	0.19
33	0.15
34	0.17
35	0.12
36	0.14
37	0.14
38	0.16
39	0.17
40	0.17
41	0.18
42	0.17
43	0.2
44	0.19
45	0.19
46	0.18
47	0.2
48	0.22
49	0.24
50	0.21
51	0.19
52	0.17
53	0.2
54	0.19
55	0.18
56	0.17
57	0.14
58	0.14
59	0.14
60	0.15
61	0.12
62	0.12
63	0.13
64	0.13
65	0.14
66	0.14
67	0.14
68	0.14
69	0.15
70	0.2
71	0.21
72	0.21
73	0.2
74	0.2
75	0.22
76	0.25
77	0.25
78	0.25
79	0.29
80	0.34
81	0.42
82	0.49
83	0.55
84	0.59
85	0.65
86	0.7
87	0.71
88	0.74
89	0.71
90	0.69
91	0.65
92	0.59
93	0.5
94	0.41
95	0.34
96	0.26
97	0.21
98	0.13
99	0.12
100	0.1
101	0.1
102	0.08
103	0.09
104	0.11
105	0.17
106	0.18
107	0.19
108	0.2
109	0.2
110	0.21
111	0.25
112	0.26
113	0.21
114	0.29
115	0.26
116	0.28
117	0.27
118	0.26
119	0.22
120	0.19
121	0.18
122	0.15
123	0.13
124	0.14
125	0.14
126	0.14
127	0.13
128	0.13
129	0.13
130	0.09
131	0.19
132	0.2
133	0.24
134	0.25
135	0.29
136	0.3
137	0.3
138	0.31
139	0.24
140	0.26
141	0.28
142	0.34
143	0.35
144	0.34
145	0.34
146	0.34
147	0.33
148	0.28
149	0.3
150	0.28
151	0.27
152	0.32
153	0.36
154	0.35
155	0.38
156	0.4
157	0.37
158	0.34
159	0.32
160	0.3
161	0.27
162	0.26
163	0.23
164	0.22
165	0.17
166	0.15
167	0.14
168	0.1
169	0.09
170	0.09
171	0.09
172	0.08
173	0.08
174	0.08
175	0.09
176	0.08
177	0.1
178	0.13
179	0.12
180	0.11
181	0.13
182	0.15
183	0.15
184	0.18
185	0.18
186	0.16
187	0.18
188	0.2
189	0.2
190	0.2
191	0.21
192	0.21
193	0.25
194	0.27
195	0.26
196	0.25
197	0.24
198	0.22
199	0.19
200	0.17
201	0.11
202	0.09
203	0.07
204	0.04
205	0.04
206	0.04
207	0.04
208	0.03
209	0.03
210	0.04
211	0.05
212	0.05
213	0.05
214	0.05
215	0.04
216	0.05
217	0.05
218	0.04
219	0.04
220	0.04
221	0.05
222	0.05
223	0.04
224	0.05
225	0.05
226	0.06
227	0.07
228	0.08
229	0.09
230	0.09
231	0.09
232	0.11
233	0.12
234	0.13
235	0.12
236	0.12
237	0.14
238	0.15
239	0.16
240	0.18
241	0.17
242	0.17
243	0.22
244	0.24
245	0.21
246	0.22
247	0.22
248	0.19
249	0.23
250	0.22
251	0.21
252	0.2
253	0.2
254	0.19
255	0.18
256	0.17
257	0.13
258	0.13
259	0.09
260	0.09
261	0.08
262	0.07
263	0.07
264	0.06
265	0.05
266	0.04
267	0.03
268	0.03
269	0.04
270	0.05
271	0.05
272	0.08
273	0.08
274	0.09
275	0.09
276	0.16
277	0.18
278	0.17
279	0.17
280	0.16
281	0.19
282	0.2
283	0.21
284	0.14
285	0.11
286	0.11
287	0.12
288	0.11
289	0.08
290	0.1
291	0.09
292	0.09
293	0.09
294	0.12
295	0.12
296	0.15
297	0.2
298	0.19
299	0.21
300	0.22
301	0.24
302	0.22
303	0.23
304	0.21
305	0.16
306	0.16
307	0.15
308	0.17
309	0.14
310	0.15
311	0.19
312	0.22
313	0.23
314	0.25
315	0.23
316	0.21
317	0.2
318	0.19
319	0.14
320	0.09
321	0.08
322	0.05
323	0.05
324	0.04
325	0.04
326	0.05
327	0.05
328	0.05
329	0.06
330	0.08
331	0.09
332	0.12
333	0.13
334	0.15
335	0.16
336	0.2
337	0.23
338	0.26
339	0.26
340	0.24
341	0.26
342	0.3
343	0.35
344	0.35
345	0.33
346	0.32
347	0.39
348	0.49
349	0.56
350	0.58
351	0.6
352	0.61
353	0.6
354	0.61
355	0.56
356	0.52
357	0.44
358	0.42
359	0.39
360	0.36
361	0.34
362	0.3
363	0.28
364	0.22
365	0.26
366	0.22
367	0.16
368	0.16
369	0.16
370	0.16
371	0.16
372	0.17
373	0.1
374	0.12
375	0.12
376	0.14
377	0.18
378	0.2
379	0.22
380	0.24
381	0.25
382	0.23
383	0.27
384	0.32
385	0.34
386	0.34
387	0.38
388	0.39
389	0.43
390	0.42
391	0.41
392	0.35
393	0.29
394	0.27
395	0.19
396	0.18
397	0.16
398	0.17
399	0.14
400	0.13
401	0.14
402	0.14
403	0.15
404	0.12
405	0.09
406	0.11
407	0.13
408	0.15
409	0.15
410	0.15
411	0.14
412	0.17
413	0.18
414	0.15
415	0.15
416	0.16
417	0.18
418	0.21
419	0.21
420	0.19
421	0.17
422	0.18
423	0.18
424	0.15
425	0.14
426	0.12
427	0.13
428	0.15
429	0.14
430	0.13
431	0.12
432	0.12
433	0.11
434	0.15
435	0.15
436	0.14
437	0.15
438	0.15
439	0.15
440	0.16
441	0.16
442	0.13
443	0.15
444	0.18
445	0.2
446	0.24
447	0.24
448	0.26
449	0.33
450	0.37
451	0.39
452	0.46
453	0.47
454	0.48
455	0.52
456	0.58
457	0.55
458	0.54
459	0.54
460	0.53
461	0.56
462	0.52
463	0.54
464	0.54
465	0.55
466	0.56
467	0.56
468	0.56
469	0.54
470	0.62
471	0.63
472	0.62
473	0.65
474	0.6
475	0.63
476	0.61
477	0.6
478	0.54
479	0.52
480	0.49
481	0.48
482	0.54
483	0.53
484	0.54
485	0.54
486	0.51
487	0.52
488	0.53

C4JNB4

3D AlphaFold-predicted Structure Viewer