Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JNB4

Protein Details
Accession C4JNB4    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGSESPEKKRKRVSEKHDRPSKKTAVEBasic
NLS Segment(s)
PositionSequence
8-23KKRKRVSEKHDRPSKK
477-508GIKRGKTEAAMKRIARLRIPVEFPKVSRGGRR
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009668  RNA_pol-assoc_fac_A49-like  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0006351  P:DNA-templated transcription  
KEGG ure:UREG_04320  -  
Pfam View protein in Pfam  
PF06870  RNA_pol_I_A49  
Amino Acid Sequences MGSESPEKKRKRVSEKHDRPSKKTAVESVLPPLKVKFIDNSDGPAPVIGAFKCQIPTAGDTLEEKQIADRIPILASTPGIRLPDSISLSAYTKPRAKRSSKTAATNSGIVSSELLLHSSAHPKFDFTAREGVEQLDSLWNHYVAIYDPKKNSLQLAEARKVTVRSCIRQASPDTEYESEEEEVQTAFSKKSALAEAFGTKQARKAVQSIAENALLSNAPGGAPTAAESALLSSMPKDAISASSAEKTAQQEIQAAKPLPQPNLSASHPSDVYSIDSLIPGGLSTLHSMPVRDWQTALANSEEILTRSRFVAHRIEAVGKTGDKSQLQLLRFILLLIEFAGSLKPTRGADKAGVGSKKIPPREDLRRKLAEATTSKDSSAGGPQFVTDSFIDSLRRKFVPQGAILSRNDLTLLHTTICALTLHVPPASGSPNASNELATDPADIRDDLGLDNKTALQYFRELGCRVDKPRESEFAKWGIKRGKTEAAMKRIARLRIPVEFPKVSRGGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.92
4 0.92
5 0.9
6 0.85
7 0.84
8 0.82
9 0.77
10 0.72
11 0.68
12 0.64
13 0.61
14 0.57
15 0.56
16 0.54
17 0.47
18 0.43
19 0.37
20 0.34
21 0.31
22 0.31
23 0.27
24 0.27
25 0.32
26 0.32
27 0.36
28 0.33
29 0.33
30 0.31
31 0.24
32 0.19
33 0.15
34 0.17
35 0.12
36 0.14
37 0.14
38 0.16
39 0.17
40 0.17
41 0.18
42 0.17
43 0.2
44 0.19
45 0.19
46 0.18
47 0.2
48 0.22
49 0.24
50 0.21
51 0.19
52 0.17
53 0.2
54 0.19
55 0.18
56 0.17
57 0.14
58 0.14
59 0.14
60 0.15
61 0.12
62 0.12
63 0.13
64 0.13
65 0.14
66 0.14
67 0.14
68 0.14
69 0.15
70 0.2
71 0.21
72 0.21
73 0.2
74 0.2
75 0.22
76 0.25
77 0.25
78 0.25
79 0.29
80 0.34
81 0.42
82 0.49
83 0.55
84 0.59
85 0.65
86 0.7
87 0.71
88 0.74
89 0.71
90 0.69
91 0.65
92 0.59
93 0.5
94 0.41
95 0.34
96 0.26
97 0.21
98 0.13
99 0.12
100 0.1
101 0.1
102 0.08
103 0.09
104 0.11
105 0.17
106 0.18
107 0.19
108 0.2
109 0.2
110 0.21
111 0.25
112 0.26
113 0.21
114 0.29
115 0.26
116 0.28
117 0.27
118 0.26
119 0.22
120 0.19
121 0.18
122 0.15
123 0.13
124 0.14
125 0.14
126 0.14
127 0.13
128 0.13
129 0.13
130 0.09
131 0.19
132 0.2
133 0.24
134 0.25
135 0.29
136 0.3
137 0.3
138 0.31
139 0.24
140 0.26
141 0.28
142 0.34
143 0.35
144 0.34
145 0.34
146 0.34
147 0.33
148 0.28
149 0.3
150 0.28
151 0.27
152 0.32
153 0.36
154 0.35
155 0.38
156 0.4
157 0.37
158 0.34
159 0.32
160 0.3
161 0.27
162 0.26
163 0.23
164 0.22
165 0.17
166 0.15
167 0.14
168 0.1
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.08
175 0.09
176 0.08
177 0.1
178 0.13
179 0.12
180 0.11
181 0.13
182 0.15
183 0.15
184 0.18
185 0.18
186 0.16
187 0.18
188 0.2
189 0.2
190 0.2
191 0.21
192 0.21
193 0.25
194 0.27
195 0.26
196 0.25
197 0.24
198 0.22
199 0.19
200 0.17
201 0.11
202 0.09
203 0.07
204 0.04
205 0.04
206 0.04
207 0.04
208 0.03
209 0.03
210 0.04
211 0.05
212 0.05
213 0.05
214 0.05
215 0.04
216 0.05
217 0.05
218 0.04
219 0.04
220 0.04
221 0.05
222 0.05
223 0.04
224 0.05
225 0.05
226 0.06
227 0.07
228 0.08
229 0.09
230 0.09
231 0.09
232 0.11
233 0.12
234 0.13
235 0.12
236 0.12
237 0.14
238 0.15
239 0.16
240 0.18
241 0.17
242 0.17
243 0.22
244 0.24
245 0.21
246 0.22
247 0.22
248 0.19
249 0.23
250 0.22
251 0.21
252 0.2
253 0.2
254 0.19
255 0.18
256 0.17
257 0.13
258 0.13
259 0.09
260 0.09
261 0.08
262 0.07
263 0.07
264 0.06
265 0.05
266 0.04
267 0.03
268 0.03
269 0.04
270 0.05
271 0.05
272 0.08
273 0.08
274 0.09
275 0.09
276 0.16
277 0.18
278 0.17
279 0.17
280 0.16
281 0.19
282 0.2
283 0.21
284 0.14
285 0.11
286 0.11
287 0.12
288 0.11
289 0.08
290 0.1
291 0.09
292 0.09
293 0.09
294 0.12
295 0.12
296 0.15
297 0.2
298 0.19
299 0.21
300 0.22
301 0.24
302 0.22
303 0.23
304 0.21
305 0.16
306 0.16
307 0.15
308 0.17
309 0.14
310 0.15
311 0.19
312 0.22
313 0.23
314 0.25
315 0.23
316 0.21
317 0.2
318 0.19
319 0.14
320 0.09
321 0.08
322 0.05
323 0.05
324 0.04
325 0.04
326 0.05
327 0.05
328 0.05
329 0.06
330 0.08
331 0.09
332 0.12
333 0.13
334 0.15
335 0.16
336 0.2
337 0.23
338 0.26
339 0.26
340 0.24
341 0.26
342 0.3
343 0.35
344 0.35
345 0.33
346 0.32
347 0.39
348 0.49
349 0.56
350 0.58
351 0.6
352 0.61
353 0.6
354 0.61
355 0.56
356 0.52
357 0.44
358 0.42
359 0.39
360 0.36
361 0.34
362 0.3
363 0.28
364 0.22
365 0.26
366 0.22
367 0.16
368 0.16
369 0.16
370 0.16
371 0.16
372 0.17
373 0.1
374 0.12
375 0.12
376 0.14
377 0.18
378 0.2
379 0.22
380 0.24
381 0.25
382 0.23
383 0.27
384 0.32
385 0.34
386 0.34
387 0.38
388 0.39
389 0.43
390 0.42
391 0.41
392 0.35
393 0.29
394 0.27
395 0.19
396 0.18
397 0.16
398 0.17
399 0.14
400 0.13
401 0.14
402 0.14
403 0.15
404 0.12
405 0.09
406 0.11
407 0.13
408 0.15
409 0.15
410 0.15
411 0.14
412 0.17
413 0.18
414 0.15
415 0.15
416 0.16
417 0.18
418 0.21
419 0.21
420 0.19
421 0.17
422 0.18
423 0.18
424 0.15
425 0.14
426 0.12
427 0.13
428 0.15
429 0.14
430 0.13
431 0.12
432 0.12
433 0.11
434 0.15
435 0.15
436 0.14
437 0.15
438 0.15
439 0.15
440 0.16
441 0.16
442 0.13
443 0.15
444 0.18
445 0.2
446 0.24
447 0.24
448 0.26
449 0.33
450 0.37
451 0.39
452 0.46
453 0.47
454 0.48
455 0.52
456 0.58
457 0.55
458 0.54
459 0.54
460 0.53
461 0.56
462 0.52
463 0.54
464 0.54
465 0.55
466 0.56
467 0.56
468 0.56
469 0.54
470 0.62
471 0.63
472 0.62
473 0.65
474 0.6
475 0.63
476 0.61
477 0.6
478 0.54
479 0.52
480 0.49
481 0.48
482 0.54
483 0.53
484 0.54
485 0.54
486 0.51
487 0.52
488 0.53