Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JDN9

Protein Details
Accession C4JDN9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-45LETSKQKPMKLSRQKFRKAALHydrophilic
NLS Segment(s)
PositionSequence
146-156GKGKRLKLKRP
Subcellular Location(s) cyto 17.5, cyto_nucl 13.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
KEGG ure:UREG_00671  -  
Pfam View protein in Pfam  
PF13391  HNH_2  
Amino Acid Sequences MADELRTGVSLEDAYAVSMVGRVALETSKQKPMKLSRQKFRKAALEYYSANNLERREVRCSLLGWSDATAVTAAHIVPRSLDKKSLGYIFGAEVEPTTDVRNSLFLHRSLKRRLDSGQIAIVPLVGNEGEWKCVVTQKDKLKDIIGKGKRLKLKRPRIVYECISALVDKSLGYRRTTVKILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.1
13 0.15
14 0.19
15 0.28
16 0.3
17 0.31
18 0.38
19 0.47
20 0.55
21 0.6
22 0.67
23 0.68
24 0.76
25 0.83
26 0.81
27 0.78
28 0.75
29 0.69
30 0.65
31 0.58
32 0.53
33 0.47
34 0.44
35 0.42
36 0.34
37 0.3
38 0.26
39 0.23
40 0.23
41 0.26
42 0.26
43 0.28
44 0.29
45 0.29
46 0.29
47 0.29
48 0.26
49 0.23
50 0.21
51 0.16
52 0.14
53 0.13
54 0.11
55 0.11
56 0.08
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.1
66 0.12
67 0.13
68 0.15
69 0.15
70 0.16
71 0.18
72 0.19
73 0.15
74 0.14
75 0.13
76 0.11
77 0.11
78 0.1
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.07
85 0.06
86 0.06
87 0.06
88 0.09
89 0.09
90 0.12
91 0.14
92 0.15
93 0.21
94 0.26
95 0.31
96 0.35
97 0.41
98 0.39
99 0.39
100 0.39
101 0.4
102 0.38
103 0.35
104 0.31
105 0.25
106 0.24
107 0.21
108 0.2
109 0.12
110 0.09
111 0.07
112 0.04
113 0.04
114 0.07
115 0.07
116 0.08
117 0.09
118 0.09
119 0.09
120 0.14
121 0.16
122 0.18
123 0.26
124 0.34
125 0.42
126 0.44
127 0.45
128 0.45
129 0.48
130 0.49
131 0.51
132 0.48
133 0.49
134 0.52
135 0.58
136 0.61
137 0.63
138 0.67
139 0.68
140 0.73
141 0.74
142 0.78
143 0.79
144 0.76
145 0.78
146 0.71
147 0.65
148 0.55
149 0.47
150 0.39
151 0.3
152 0.25
153 0.19
154 0.16
155 0.11
156 0.13
157 0.19
158 0.21
159 0.23
160 0.28
161 0.31
162 0.36