Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060S434

Protein Details
Accession A0A060S434    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-59DARRGVPKRRDDEKHKPSKIBasic
NLS Segment(s)
PositionSequence
42-59RRGVPKRRDDEKHKPSKI
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 6.5, cyto 4.5, pero 4
Family & Domain DBs
Amino Acid Sequences MNSGFVLFFITLLAMALFVSATPVPNNDAALVKKALKQYDARRGVPKRRDDEKHKPSKIWRAAIPEPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.03
6 0.05
7 0.05
8 0.06
9 0.06
10 0.07
11 0.09
12 0.09
13 0.1
14 0.09
15 0.11
16 0.11
17 0.13
18 0.14
19 0.13
20 0.16
21 0.18
22 0.18
23 0.18
24 0.24
25 0.28
26 0.37
27 0.42
28 0.42
29 0.48
30 0.54
31 0.61
32 0.63
33 0.65
34 0.62
35 0.65
36 0.7
37 0.71
38 0.76
39 0.77
40 0.8
41 0.76
42 0.75
43 0.74
44 0.76
45 0.76
46 0.71
47 0.65
48 0.62
49 0.64