Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SIC7

Protein Details
Accession A0A060SIC7    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-113ITSTPSPPSHRRRRADRPIVTPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 9, mito 8, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022137  Znf_prot_DUF3669  
Pfam View protein in Pfam  
PF12417  DUF3669  
Amino Acid Sequences MVSRTTSLPTIADDLETAAPVRLGAGSFATVFVISGGPVVYKQVHTVEHASTLLDEYNTLDKIYSHCHTDSFFAIPRALAFNNPLAEYGGFITSTPSPPSHRRRRADRPIVTPAVMHVFDAPVYAMDRVHALPLDVRNFLKEKFFPPAVNVGPALCRLYFGKKYPIITEPKFVNSQNFPLDADRYAMLRSYLTILPPASEVAEGMGEMLGRMHNVAGVDARDVEFVLGGDGSGGYTFFIIDFNQASLQLSVDVYEATDNDQVRKWSKVVDDVGDIVQPFFANDPYYPRPRPGDDLYEAFKSAYLAQYGSQTKPVGLAFLQAIEREQASRDARHAGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.13
5 0.1
6 0.1
7 0.09
8 0.09
9 0.07
10 0.07
11 0.07
12 0.08
13 0.08
14 0.09
15 0.09
16 0.09
17 0.08
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.08
27 0.1
28 0.1
29 0.13
30 0.15
31 0.16
32 0.19
33 0.22
34 0.21
35 0.21
36 0.21
37 0.19
38 0.16
39 0.16
40 0.14
41 0.1
42 0.1
43 0.1
44 0.13
45 0.13
46 0.12
47 0.12
48 0.11
49 0.13
50 0.19
51 0.19
52 0.2
53 0.2
54 0.21
55 0.22
56 0.24
57 0.24
58 0.21
59 0.22
60 0.2
61 0.2
62 0.18
63 0.18
64 0.19
65 0.17
66 0.15
67 0.14
68 0.16
69 0.17
70 0.17
71 0.16
72 0.14
73 0.14
74 0.13
75 0.12
76 0.1
77 0.08
78 0.08
79 0.1
80 0.1
81 0.12
82 0.13
83 0.13
84 0.18
85 0.27
86 0.37
87 0.46
88 0.55
89 0.61
90 0.69
91 0.78
92 0.84
93 0.86
94 0.82
95 0.78
96 0.76
97 0.7
98 0.61
99 0.5
100 0.4
101 0.33
102 0.26
103 0.19
104 0.12
105 0.1
106 0.09
107 0.09
108 0.08
109 0.05
110 0.06
111 0.06
112 0.05
113 0.06
114 0.07
115 0.07
116 0.08
117 0.07
118 0.06
119 0.09
120 0.12
121 0.13
122 0.14
123 0.14
124 0.15
125 0.17
126 0.17
127 0.18
128 0.17
129 0.17
130 0.21
131 0.22
132 0.2
133 0.21
134 0.25
135 0.22
136 0.21
137 0.19
138 0.14
139 0.13
140 0.14
141 0.13
142 0.08
143 0.08
144 0.08
145 0.13
146 0.16
147 0.17
148 0.23
149 0.24
150 0.26
151 0.27
152 0.31
153 0.33
154 0.31
155 0.33
156 0.28
157 0.28
158 0.29
159 0.27
160 0.26
161 0.2
162 0.22
163 0.2
164 0.19
165 0.17
166 0.16
167 0.17
168 0.13
169 0.13
170 0.11
171 0.1
172 0.09
173 0.09
174 0.08
175 0.07
176 0.07
177 0.09
178 0.09
179 0.09
180 0.1
181 0.1
182 0.1
183 0.1
184 0.1
185 0.07
186 0.07
187 0.06
188 0.05
189 0.05
190 0.04
191 0.04
192 0.04
193 0.03
194 0.03
195 0.04
196 0.03
197 0.03
198 0.04
199 0.03
200 0.04
201 0.05
202 0.05
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.06
211 0.05
212 0.05
213 0.05
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.04
226 0.04
227 0.06
228 0.06
229 0.07
230 0.08
231 0.08
232 0.09
233 0.09
234 0.09
235 0.08
236 0.07
237 0.07
238 0.07
239 0.07
240 0.06
241 0.06
242 0.06
243 0.08
244 0.11
245 0.11
246 0.13
247 0.15
248 0.19
249 0.21
250 0.24
251 0.22
252 0.23
253 0.24
254 0.29
255 0.3
256 0.29
257 0.28
258 0.27
259 0.26
260 0.23
261 0.22
262 0.15
263 0.12
264 0.1
265 0.09
266 0.08
267 0.08
268 0.09
269 0.1
270 0.17
271 0.23
272 0.31
273 0.32
274 0.36
275 0.4
276 0.42
277 0.48
278 0.46
279 0.47
280 0.44
281 0.47
282 0.46
283 0.42
284 0.39
285 0.32
286 0.27
287 0.21
288 0.19
289 0.17
290 0.14
291 0.13
292 0.13
293 0.21
294 0.24
295 0.24
296 0.27
297 0.25
298 0.24
299 0.26
300 0.25
301 0.21
302 0.17
303 0.18
304 0.14
305 0.16
306 0.17
307 0.14
308 0.15
309 0.15
310 0.15
311 0.13
312 0.15
313 0.19
314 0.23
315 0.25
316 0.27
317 0.3