Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A060SCJ6

Protein Details
Accession A0A060SCJ6    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
269-293LDKEGPDKRGRKKKGGKDGGKKDGABasic
NLS Segment(s)
PositionSequence
274-291PDKRGRKKKGGKDGGKKD
340-361KIRNLNKKLKAIEELKEKQKKG
Subcellular Location(s) mito 12.5, mito_nucl 11.166, nucl 8.5, cyto_nucl 8.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011387  TIF2A  
IPR013979  TIF_beta_prop-like  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF08662  eIF2A  
Amino Acid Sequences MASQLSQQYAYRAQKSIGLVGGTPNYDPIDSFQPPDVPARTFKYSPDGRLFAYAIPTGVRIYQAESAQLLQELSLSNIVDISFSPRGTYLSTWERPIKLEDGSQHKNLRVFSVSTGEELVAFSQKSQEGWELQFTISESHAVRLVGQEIQVFRPVEWSKGVVDKLKVEGATSVTLSPGLNPSVAVFVAEKKGQPASVKIYSLTALAAPPTCQKTFFKAQRSQIKWNTLGTQVLVLTQTDVDQANKSYYGETGGLYLLSAAGNFDCRVALDKEGPDKRGRKKKGGKDGGKKDGAATPAGGEASARPSIDIPPNGAAEAVAANGSVPPTPGGEGSLDPTAKKIRNLNKKLKAIEELKEKQKKGERLEATQLKKIDTEADIRKELAGLGISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.4
3 0.39
4 0.33
5 0.27
6 0.23
7 0.24
8 0.26
9 0.22
10 0.19
11 0.18
12 0.16
13 0.15
14 0.15
15 0.15
16 0.2
17 0.2
18 0.23
19 0.23
20 0.24
21 0.26
22 0.31
23 0.3
24 0.26
25 0.29
26 0.33
27 0.37
28 0.36
29 0.36
30 0.4
31 0.42
32 0.46
33 0.48
34 0.44
35 0.39
36 0.42
37 0.41
38 0.33
39 0.31
40 0.25
41 0.18
42 0.16
43 0.16
44 0.13
45 0.13
46 0.13
47 0.1
48 0.13
49 0.16
50 0.16
51 0.17
52 0.17
53 0.17
54 0.16
55 0.16
56 0.13
57 0.08
58 0.09
59 0.08
60 0.08
61 0.09
62 0.09
63 0.08
64 0.09
65 0.09
66 0.08
67 0.08
68 0.13
69 0.13
70 0.13
71 0.14
72 0.14
73 0.15
74 0.17
75 0.17
76 0.17
77 0.24
78 0.26
79 0.31
80 0.34
81 0.34
82 0.34
83 0.36
84 0.32
85 0.25
86 0.26
87 0.27
88 0.32
89 0.35
90 0.4
91 0.4
92 0.4
93 0.42
94 0.39
95 0.36
96 0.3
97 0.26
98 0.22
99 0.23
100 0.21
101 0.18
102 0.18
103 0.15
104 0.13
105 0.12
106 0.11
107 0.08
108 0.08
109 0.07
110 0.09
111 0.1
112 0.1
113 0.11
114 0.13
115 0.14
116 0.15
117 0.17
118 0.16
119 0.15
120 0.16
121 0.15
122 0.13
123 0.11
124 0.12
125 0.11
126 0.1
127 0.12
128 0.11
129 0.11
130 0.1
131 0.11
132 0.1
133 0.1
134 0.11
135 0.1
136 0.11
137 0.15
138 0.15
139 0.13
140 0.19
141 0.19
142 0.19
143 0.19
144 0.19
145 0.16
146 0.19
147 0.21
148 0.17
149 0.18
150 0.17
151 0.18
152 0.19
153 0.17
154 0.14
155 0.13
156 0.12
157 0.11
158 0.1
159 0.09
160 0.07
161 0.08
162 0.08
163 0.07
164 0.07
165 0.07
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.07
172 0.05
173 0.06
174 0.08
175 0.09
176 0.09
177 0.09
178 0.09
179 0.1
180 0.11
181 0.12
182 0.16
183 0.17
184 0.18
185 0.17
186 0.17
187 0.16
188 0.15
189 0.13
190 0.08
191 0.06
192 0.06
193 0.06
194 0.06
195 0.09
196 0.12
197 0.12
198 0.14
199 0.15
200 0.2
201 0.29
202 0.35
203 0.4
204 0.44
205 0.52
206 0.6
207 0.64
208 0.67
209 0.64
210 0.63
211 0.56
212 0.51
213 0.45
214 0.37
215 0.32
216 0.23
217 0.18
218 0.13
219 0.11
220 0.1
221 0.08
222 0.06
223 0.06
224 0.06
225 0.06
226 0.07
227 0.07
228 0.08
229 0.09
230 0.09
231 0.1
232 0.1
233 0.09
234 0.09
235 0.1
236 0.1
237 0.09
238 0.09
239 0.08
240 0.08
241 0.07
242 0.07
243 0.05
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.06
251 0.05
252 0.06
253 0.09
254 0.1
255 0.12
256 0.15
257 0.17
258 0.26
259 0.29
260 0.31
261 0.35
262 0.42
263 0.5
264 0.57
265 0.61
266 0.63
267 0.7
268 0.78
269 0.82
270 0.85
271 0.85
272 0.85
273 0.88
274 0.86
275 0.79
276 0.69
277 0.6
278 0.52
279 0.44
280 0.34
281 0.24
282 0.16
283 0.14
284 0.14
285 0.12
286 0.08
287 0.07
288 0.1
289 0.11
290 0.11
291 0.1
292 0.11
293 0.16
294 0.22
295 0.22
296 0.21
297 0.22
298 0.23
299 0.22
300 0.21
301 0.17
302 0.11
303 0.1
304 0.08
305 0.05
306 0.04
307 0.04
308 0.05
309 0.06
310 0.05
311 0.06
312 0.06
313 0.07
314 0.08
315 0.08
316 0.09
317 0.1
318 0.11
319 0.13
320 0.17
321 0.17
322 0.16
323 0.19
324 0.25
325 0.26
326 0.31
327 0.37
328 0.42
329 0.53
330 0.63
331 0.71
332 0.74
333 0.79
334 0.78
335 0.74
336 0.72
337 0.66
338 0.64
339 0.63
340 0.61
341 0.64
342 0.69
343 0.65
344 0.65
345 0.69
346 0.7
347 0.67
348 0.7
349 0.65
350 0.63
351 0.73
352 0.73
353 0.69
354 0.67
355 0.61
356 0.52
357 0.47
358 0.41
359 0.35
360 0.28
361 0.32
362 0.33
363 0.38
364 0.38
365 0.38
366 0.37
367 0.33
368 0.31
369 0.25