Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A060SEW5

Protein Details
Accession A0A060SEW5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
312-337LLILLRRRRRIVRRRRHKTALPSPILHydrophilic
NLS Segment(s)
PositionSequence
317-329RRRRRIVRRRRHK
Subcellular Location(s) nucl 8.5, extr 7, cyto_nucl 6.5, mito 4, cyto 3.5, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAASNVTGTFPASVQEAHPFHCGLTLRARHAPCPVDDSSSRIVYDPPDAWQSLAGSAARAYANSTMHGTAVSGAIARLTFNGTGVWFYGAKKPEYGSFILMVDKDVLTYANASAATPEFGQLLGGVSGLKNGQHVVSIMNGGTGPMDLDAIVFESVDQQQPKAIAHASVAQTGASSSQSPAPSGSAGRLSATPNAFSGNSPNAGATSDPGTPSTSSVDNAPADANAQPAAAPAAVTAVPNAAPASPVNTDSSVSDAQASAFPNASFSNASQPERTSGIGGSSASNSHRGLPKGVIIGIAVGCAVVVLIAAFLLILLRRRRRIVRRRRHKTALPSPILPLQDPDTEFGYFFRGQGAMSEKRDQYLGRPDSLSTQSSSDSGKTLRGYEGPYGEKDVTELPTPLPPQPAYMSSYATNTAHYNKASIDNGSDITDMYSRTDPGTPVRPPRPPELRLST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.21
3 0.21
4 0.23
5 0.25
6 0.25
7 0.23
8 0.27
9 0.27
10 0.21
11 0.29
12 0.32
13 0.35
14 0.43
15 0.45
16 0.42
17 0.48
18 0.48
19 0.4
20 0.41
21 0.37
22 0.35
23 0.34
24 0.37
25 0.35
26 0.33
27 0.32
28 0.27
29 0.27
30 0.22
31 0.27
32 0.22
33 0.21
34 0.22
35 0.22
36 0.22
37 0.22
38 0.21
39 0.16
40 0.18
41 0.15
42 0.12
43 0.11
44 0.13
45 0.12
46 0.11
47 0.12
48 0.14
49 0.14
50 0.15
51 0.17
52 0.15
53 0.15
54 0.15
55 0.13
56 0.11
57 0.1
58 0.09
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.1
72 0.12
73 0.1
74 0.12
75 0.18
76 0.21
77 0.21
78 0.22
79 0.23
80 0.25
81 0.28
82 0.28
83 0.23
84 0.21
85 0.21
86 0.21
87 0.2
88 0.17
89 0.14
90 0.12
91 0.1
92 0.09
93 0.08
94 0.07
95 0.08
96 0.07
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.1
103 0.09
104 0.09
105 0.07
106 0.07
107 0.07
108 0.06
109 0.07
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.07
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.08
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.06
142 0.07
143 0.11
144 0.11
145 0.1
146 0.12
147 0.13
148 0.13
149 0.13
150 0.12
151 0.09
152 0.1
153 0.15
154 0.14
155 0.15
156 0.14
157 0.12
158 0.12
159 0.11
160 0.11
161 0.07
162 0.07
163 0.07
164 0.1
165 0.11
166 0.11
167 0.12
168 0.12
169 0.12
170 0.12
171 0.12
172 0.09
173 0.09
174 0.1
175 0.1
176 0.11
177 0.14
178 0.14
179 0.14
180 0.12
181 0.14
182 0.13
183 0.12
184 0.14
185 0.12
186 0.12
187 0.11
188 0.11
189 0.1
190 0.1
191 0.1
192 0.07
193 0.08
194 0.08
195 0.08
196 0.09
197 0.1
198 0.1
199 0.1
200 0.12
201 0.1
202 0.1
203 0.1
204 0.12
205 0.11
206 0.11
207 0.1
208 0.08
209 0.09
210 0.08
211 0.08
212 0.06
213 0.06
214 0.05
215 0.05
216 0.05
217 0.04
218 0.04
219 0.03
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.05
228 0.04
229 0.04
230 0.04
231 0.07
232 0.08
233 0.09
234 0.1
235 0.1
236 0.1
237 0.1
238 0.13
239 0.11
240 0.1
241 0.1
242 0.09
243 0.09
244 0.11
245 0.12
246 0.09
247 0.09
248 0.09
249 0.1
250 0.1
251 0.11
252 0.09
253 0.09
254 0.16
255 0.18
256 0.2
257 0.2
258 0.2
259 0.21
260 0.22
261 0.22
262 0.15
263 0.12
264 0.11
265 0.11
266 0.11
267 0.09
268 0.08
269 0.09
270 0.09
271 0.12
272 0.12
273 0.14
274 0.18
275 0.18
276 0.2
277 0.19
278 0.21
279 0.19
280 0.19
281 0.16
282 0.11
283 0.11
284 0.09
285 0.08
286 0.06
287 0.04
288 0.04
289 0.03
290 0.03
291 0.02
292 0.02
293 0.02
294 0.02
295 0.02
296 0.02
297 0.02
298 0.02
299 0.02
300 0.03
301 0.08
302 0.15
303 0.2
304 0.24
305 0.29
306 0.38
307 0.49
308 0.59
309 0.65
310 0.71
311 0.77
312 0.84
313 0.89
314 0.89
315 0.86
316 0.85
317 0.84
318 0.84
319 0.77
320 0.68
321 0.61
322 0.56
323 0.5
324 0.39
325 0.31
326 0.23
327 0.22
328 0.22
329 0.21
330 0.19
331 0.18
332 0.18
333 0.17
334 0.18
335 0.15
336 0.14
337 0.14
338 0.12
339 0.11
340 0.14
341 0.2
342 0.21
343 0.25
344 0.31
345 0.3
346 0.3
347 0.32
348 0.3
349 0.29
350 0.34
351 0.33
352 0.3
353 0.3
354 0.3
355 0.34
356 0.37
357 0.33
358 0.24
359 0.22
360 0.2
361 0.21
362 0.22
363 0.18
364 0.17
365 0.16
366 0.19
367 0.19
368 0.2
369 0.21
370 0.22
371 0.24
372 0.25
373 0.29
374 0.28
375 0.28
376 0.31
377 0.29
378 0.26
379 0.24
380 0.23
381 0.21
382 0.2
383 0.19
384 0.16
385 0.21
386 0.23
387 0.24
388 0.26
389 0.24
390 0.25
391 0.27
392 0.28
393 0.27
394 0.27
395 0.27
396 0.23
397 0.25
398 0.26
399 0.23
400 0.23
401 0.22
402 0.24
403 0.26
404 0.25
405 0.25
406 0.23
407 0.28
408 0.28
409 0.27
410 0.25
411 0.23
412 0.23
413 0.23
414 0.21
415 0.16
416 0.16
417 0.16
418 0.15
419 0.16
420 0.17
421 0.16
422 0.18
423 0.21
424 0.21
425 0.25
426 0.32
427 0.36
428 0.44
429 0.51
430 0.56
431 0.58
432 0.66
433 0.69
434 0.65