Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JGD7

Protein Details
Accession C4JGD7   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
165-194LSTTDPSLKPKKKKPGKKRRIMLRNRVAAKHydrophilic
197-231AEEADREKRTRRNREKKIKRRQREREKKTALQTVEBasic
NLS Segment(s)
PositionSequence
173-224KPKKKKPGKKRRIMLRNRVAAKAAAEEADREKRTRRNREKKIKRRQREREKK
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
KEGG ure:UREG_01128  -  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MNEEEEEQEFEFRLFRSTAPDALGGEKQDGPIDTGGGIEKEETRNVPAVHKIRVKLRSPSPSRSAEGGFTVPFRAWDYYFSDPELVMRVFKERFGKSPSGACEFISKDPKKQERRQNYLEVAVTSDQVLAAANSGVWPGCHLPWRVIHFAAPFSKTSKVPSQTPLSTTDPSLKPKKKKPGKKRRIMLRNRVAAKAAAEEADREKRTRRNREKKIKRRQREREKKTALQTVEHGTGVDLSESMSLSGNDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.19
4 0.22
5 0.24
6 0.24
7 0.25
8 0.22
9 0.25
10 0.26
11 0.2
12 0.2
13 0.19
14 0.18
15 0.18
16 0.18
17 0.16
18 0.15
19 0.14
20 0.11
21 0.11
22 0.11
23 0.1
24 0.09
25 0.08
26 0.1
27 0.12
28 0.14
29 0.15
30 0.16
31 0.21
32 0.21
33 0.23
34 0.29
35 0.31
36 0.36
37 0.4
38 0.41
39 0.44
40 0.51
41 0.53
42 0.52
43 0.56
44 0.6
45 0.61
46 0.64
47 0.62
48 0.59
49 0.57
50 0.51
51 0.45
52 0.36
53 0.32
54 0.26
55 0.21
56 0.17
57 0.15
58 0.12
59 0.12
60 0.13
61 0.13
62 0.12
63 0.14
64 0.18
65 0.21
66 0.22
67 0.22
68 0.2
69 0.18
70 0.18
71 0.18
72 0.14
73 0.1
74 0.1
75 0.13
76 0.13
77 0.16
78 0.22
79 0.2
80 0.24
81 0.29
82 0.31
83 0.28
84 0.32
85 0.32
86 0.31
87 0.3
88 0.26
89 0.25
90 0.24
91 0.26
92 0.32
93 0.3
94 0.3
95 0.38
96 0.46
97 0.52
98 0.59
99 0.65
100 0.65
101 0.72
102 0.73
103 0.7
104 0.63
105 0.57
106 0.49
107 0.39
108 0.3
109 0.22
110 0.17
111 0.11
112 0.09
113 0.06
114 0.05
115 0.05
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.04
125 0.05
126 0.06
127 0.1
128 0.11
129 0.13
130 0.17
131 0.22
132 0.23
133 0.22
134 0.23
135 0.2
136 0.22
137 0.22
138 0.2
139 0.16
140 0.17
141 0.19
142 0.18
143 0.22
144 0.26
145 0.27
146 0.28
147 0.32
148 0.36
149 0.35
150 0.36
151 0.37
152 0.34
153 0.31
154 0.3
155 0.32
156 0.29
157 0.34
158 0.43
159 0.45
160 0.5
161 0.58
162 0.68
163 0.72
164 0.8
165 0.85
166 0.86
167 0.89
168 0.91
169 0.92
170 0.92
171 0.92
172 0.91
173 0.91
174 0.89
175 0.87
176 0.79
177 0.72
178 0.62
179 0.52
180 0.43
181 0.34
182 0.25
183 0.17
184 0.14
185 0.14
186 0.18
187 0.24
188 0.25
189 0.25
190 0.3
191 0.38
192 0.48
193 0.58
194 0.65
195 0.68
196 0.78
197 0.87
198 0.93
199 0.95
200 0.96
201 0.96
202 0.96
203 0.96
204 0.96
205 0.96
206 0.96
207 0.94
208 0.94
209 0.92
210 0.89
211 0.86
212 0.83
213 0.74
214 0.66
215 0.61
216 0.55
217 0.48
218 0.4
219 0.32
220 0.24
221 0.22
222 0.19
223 0.15
224 0.09
225 0.07
226 0.08
227 0.08
228 0.09
229 0.09