Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JTV1

Protein Details
Accession C4JTV1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-125GYVLLRRAKRKEFREWKRQRDEVSTKHydrophilic
NLS Segment(s)
PositionSequence
106-116RAKRKEFREWK
Subcellular Location(s) mito 7extr 7, E.R. 5, cyto 4, plas 2, cyto_nucl 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018937  MMgT  
Gene Ontology GO:0016020  C:membrane  
GO:0051234  P:establishment of localization  
KEGG ure:UREG_05890  -  
Pfam View protein in Pfam  
PF10270  MMgT  
Amino Acid Sequences MTFPSRLLTTFGLIFLAHAGYSAHEHSVLYGSTHPLPLDITLETLVAVVLVIFGLVLGAEKPKPISWSAWAGEIERKGGSENPFLGLEERRAFIDIRVMGYVLLRRAKRKEFREWKRQRDEVSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.06
5 0.06
6 0.06
7 0.06
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.1
14 0.11
15 0.1
16 0.09
17 0.09
18 0.12
19 0.12
20 0.13
21 0.12
22 0.11
23 0.11
24 0.11
25 0.11
26 0.08
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.06
33 0.04
34 0.04
35 0.03
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.01
42 0.01
43 0.02
44 0.02
45 0.03
46 0.03
47 0.04
48 0.05
49 0.06
50 0.07
51 0.08
52 0.1
53 0.11
54 0.16
55 0.16
56 0.18
57 0.18
58 0.18
59 0.2
60 0.19
61 0.17
62 0.13
63 0.13
64 0.11
65 0.14
66 0.16
67 0.16
68 0.16
69 0.17
70 0.17
71 0.18
72 0.18
73 0.16
74 0.17
75 0.15
76 0.16
77 0.14
78 0.15
79 0.15
80 0.14
81 0.19
82 0.16
83 0.16
84 0.16
85 0.16
86 0.14
87 0.15
88 0.17
89 0.15
90 0.21
91 0.22
92 0.28
93 0.34
94 0.44
95 0.52
96 0.56
97 0.63
98 0.68
99 0.76
100 0.81
101 0.85
102 0.86
103 0.87
104 0.87
105 0.81