Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JUD3

Protein Details
Accession C4JUD3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-29ATKIKGEKSDIKRKIKKVTLHydrophilic
NLS Segment(s)
PositionSequence
15-26GEKSDIKRKIKK
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
KEGG ure:UREG_06072  -  
Amino Acid Sequences MILNQQALRATKIKGEKSDIKRKIKKVTLEDEYAKKIDNKNKNFKKEDGMILYHRLIYVSRKIRNEVMVQEHDTVTSASTKQWRRSQGHTIDQKCGQTFNNMSKNVRHVHEAKSTSNNHMGSYSQYHNCEDHGNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.51
4 0.57
5 0.67
6 0.7
7 0.73
8 0.76
9 0.79
10 0.82
11 0.79
12 0.78
13 0.75
14 0.74
15 0.69
16 0.66
17 0.64
18 0.57
19 0.53
20 0.45
21 0.39
22 0.34
23 0.35
24 0.39
25 0.43
26 0.49
27 0.57
28 0.65
29 0.72
30 0.73
31 0.68
32 0.65
33 0.6
34 0.56
35 0.48
36 0.43
37 0.36
38 0.34
39 0.32
40 0.26
41 0.21
42 0.17
43 0.13
44 0.13
45 0.19
46 0.23
47 0.27
48 0.29
49 0.31
50 0.32
51 0.34
52 0.34
53 0.29
54 0.26
55 0.24
56 0.24
57 0.23
58 0.21
59 0.18
60 0.17
61 0.14
62 0.1
63 0.09
64 0.07
65 0.08
66 0.16
67 0.2
68 0.27
69 0.33
70 0.4
71 0.43
72 0.48
73 0.56
74 0.56
75 0.6
76 0.62
77 0.59
78 0.56
79 0.55
80 0.52
81 0.43
82 0.38
83 0.29
84 0.27
85 0.27
86 0.31
87 0.36
88 0.37
89 0.38
90 0.39
91 0.43
92 0.42
93 0.4
94 0.37
95 0.33
96 0.35
97 0.42
98 0.43
99 0.41
100 0.45
101 0.46
102 0.45
103 0.49
104 0.44
105 0.36
106 0.34
107 0.31
108 0.27
109 0.3
110 0.31
111 0.29
112 0.31
113 0.33
114 0.33
115 0.34