Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B5FV71

Protein Details
Accession B5FV71   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-72GRPQKKTEVKISRNKNRNKKHSSKDLQTHydrophilic
NLS Segment(s)
PositionSequence
52-64EVKISRNKNRNKK
Subcellular Location(s) nucl 7.5, cyto_nucl 5.5, plas 5, mito 4, E.R. 3, golg 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG kla:KLLA0_D00269g  -  
Amino Acid Sequences MRQITMSQNREDTCCVTVCNFECSVKPFNLARRTFSQPWQLRLYGRPQKKTEVKISRNKNRNKKHSSKDLQTFFIAAGVILALVLLQYQTCFAFFFFGFSFPVFLSNLHSLCVVHRKKLHVQSVDLGISKRSTQKNAALPIQMPVLRSSDNKIKKNSGFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.2
4 0.25
5 0.24
6 0.25
7 0.24
8 0.23
9 0.24
10 0.27
11 0.3
12 0.25
13 0.28
14 0.27
15 0.34
16 0.42
17 0.42
18 0.42
19 0.43
20 0.51
21 0.5
22 0.51
23 0.54
24 0.49
25 0.52
26 0.52
27 0.48
28 0.42
29 0.42
30 0.47
31 0.46
32 0.48
33 0.51
34 0.49
35 0.56
36 0.61
37 0.63
38 0.64
39 0.65
40 0.66
41 0.68
42 0.76
43 0.77
44 0.79
45 0.82
46 0.82
47 0.82
48 0.84
49 0.84
50 0.84
51 0.81
52 0.83
53 0.81
54 0.79
55 0.77
56 0.7
57 0.63
58 0.53
59 0.46
60 0.34
61 0.27
62 0.19
63 0.1
64 0.06
65 0.04
66 0.03
67 0.03
68 0.02
69 0.02
70 0.01
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.03
77 0.04
78 0.04
79 0.04
80 0.07
81 0.07
82 0.09
83 0.09
84 0.1
85 0.1
86 0.1
87 0.11
88 0.09
89 0.1
90 0.08
91 0.08
92 0.12
93 0.14
94 0.14
95 0.14
96 0.14
97 0.13
98 0.14
99 0.24
100 0.21
101 0.24
102 0.28
103 0.32
104 0.4
105 0.49
106 0.55
107 0.49
108 0.5
109 0.47
110 0.48
111 0.45
112 0.38
113 0.3
114 0.23
115 0.21
116 0.21
117 0.25
118 0.25
119 0.27
120 0.31
121 0.38
122 0.44
123 0.49
124 0.5
125 0.46
126 0.42
127 0.4
128 0.4
129 0.33
130 0.27
131 0.22
132 0.21
133 0.21
134 0.22
135 0.26
136 0.31
137 0.4
138 0.45
139 0.5
140 0.56