Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZT35

Protein Details
Accession A0A093ZT35   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
129-153EGGQKTQKKEKKEKAPKPQKAPAPTBasic
NLS Segment(s)
PositionSequence
87-94KERIKKEK
117-150AKGPKEGAAAGGEGGQKTQKKEKKEKAPKPQKAP
Subcellular Location(s) cyto 21.5, cyto_nucl 11.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR012340  NA-bd_OB-fold  
IPR002547  tRNA-bd_dom  
Gene Ontology GO:0000049  F:tRNA binding  
PROSITE View protein in PROSITE  
PS50886  TRBD  
Amino Acid Sequences LATRTTLLGALPSVADVELYKALSPAIASWTPEERTGKEGHPNLVRHMDFVQGSDLFGLGISEADRVKVDKDEVLFVKPPVDAKAEKERIKKEKAAAAAAAAAGGAQTTLPDRSGNAKGPKEGAAAGGEGGQKTQKKEKKEKAPKPQKAPAPTAPLSPSLIDLRVGHILKAIKHPEADSLFVSTIAMGDKPGTDDTEEVDGVWCATSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.08
5 0.09
6 0.1
7 0.1
8 0.09
9 0.1
10 0.09
11 0.09
12 0.08
13 0.12
14 0.12
15 0.13
16 0.16
17 0.2
18 0.21
19 0.26
20 0.28
21 0.24
22 0.26
23 0.28
24 0.28
25 0.33
26 0.35
27 0.36
28 0.4
29 0.4
30 0.41
31 0.46
32 0.43
33 0.36
34 0.33
35 0.31
36 0.24
37 0.23
38 0.22
39 0.14
40 0.14
41 0.12
42 0.11
43 0.08
44 0.07
45 0.06
46 0.03
47 0.03
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.07
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.15
60 0.16
61 0.18
62 0.18
63 0.17
64 0.17
65 0.16
66 0.16
67 0.13
68 0.15
69 0.14
70 0.17
71 0.27
72 0.33
73 0.38
74 0.43
75 0.49
76 0.52
77 0.55
78 0.55
79 0.48
80 0.44
81 0.41
82 0.37
83 0.29
84 0.23
85 0.19
86 0.15
87 0.11
88 0.07
89 0.04
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.03
97 0.04
98 0.04
99 0.05
100 0.1
101 0.13
102 0.19
103 0.24
104 0.25
105 0.25
106 0.27
107 0.27
108 0.23
109 0.21
110 0.16
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.08
118 0.11
119 0.12
120 0.15
121 0.25
122 0.27
123 0.35
124 0.46
125 0.56
126 0.64
127 0.73
128 0.8
129 0.82
130 0.89
131 0.89
132 0.88
133 0.86
134 0.81
135 0.76
136 0.73
137 0.67
138 0.64
139 0.56
140 0.5
141 0.44
142 0.38
143 0.33
144 0.27
145 0.23
146 0.17
147 0.16
148 0.15
149 0.14
150 0.15
151 0.2
152 0.2
153 0.17
154 0.2
155 0.21
156 0.22
157 0.29
158 0.3
159 0.26
160 0.27
161 0.28
162 0.3
163 0.3
164 0.3
165 0.23
166 0.22
167 0.21
168 0.19
169 0.19
170 0.12
171 0.11
172 0.1
173 0.09
174 0.06
175 0.07
176 0.07
177 0.1
178 0.11
179 0.12
180 0.12
181 0.13
182 0.15
183 0.18
184 0.17
185 0.15
186 0.15
187 0.13
188 0.13
189 0.12