Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A1U3

Protein Details
Accession A0A094A1U3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-61LGRNELKLRLKRKAKKAKLTGMPHEBasic
NLS Segment(s)
PositionSequence
43-54KLRLKRKAKKAK
Subcellular Location(s) mito 12, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR040152  Atp25  
IPR043519  NT_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0140053  P:mitochondrial gene expression  
Pfam View protein in Pfam  
PF02410  RsfS  
Amino Acid Sequences MVIGTARSEKHLHVSADRLCRWLRTEYKLRPDADGLLGRNELKLRLKRKAKKAKLTGMPHEDDADDGVRTGWVCVNVGTVESAEGAQSEVTQLDTGFVGFGRQSEGTKIVVQMLVEEKRAELDLERLWSGIARRQTSGLVAEVDADGFVEASEGSVDNTQPQDLSPVVKVHDAYATPFPTTSSFSPVAIQPKDSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.46
4 0.46
5 0.43
6 0.38
7 0.38
8 0.39
9 0.4
10 0.4
11 0.4
12 0.49
13 0.53
14 0.62
15 0.66
16 0.64
17 0.58
18 0.54
19 0.48
20 0.43
21 0.39
22 0.3
23 0.26
24 0.26
25 0.24
26 0.24
27 0.22
28 0.2
29 0.24
30 0.3
31 0.34
32 0.42
33 0.53
34 0.6
35 0.7
36 0.78
37 0.8
38 0.83
39 0.86
40 0.86
41 0.85
42 0.83
43 0.8
44 0.75
45 0.67
46 0.57
47 0.49
48 0.39
49 0.29
50 0.23
51 0.16
52 0.1
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.07
61 0.07
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.03
87 0.04
88 0.05
89 0.06
90 0.06
91 0.07
92 0.09
93 0.1
94 0.11
95 0.11
96 0.1
97 0.1
98 0.09
99 0.09
100 0.12
101 0.11
102 0.11
103 0.11
104 0.1
105 0.1
106 0.11
107 0.1
108 0.07
109 0.09
110 0.09
111 0.11
112 0.12
113 0.11
114 0.11
115 0.11
116 0.12
117 0.14
118 0.18
119 0.18
120 0.19
121 0.2
122 0.2
123 0.2
124 0.21
125 0.17
126 0.12
127 0.11
128 0.1
129 0.09
130 0.09
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.05
142 0.06
143 0.07
144 0.09
145 0.1
146 0.1
147 0.1
148 0.1
149 0.12
150 0.12
151 0.14
152 0.14
153 0.15
154 0.16
155 0.19
156 0.19
157 0.17
158 0.2
159 0.18
160 0.19
161 0.23
162 0.23
163 0.22
164 0.22
165 0.22
166 0.2
167 0.25
168 0.22
169 0.23
170 0.23
171 0.23
172 0.25
173 0.28
174 0.34
175 0.31