Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094AJS9

Protein Details
Accession A0A094AJS9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-100DAWEEMKRQKEKKKSLWRMKREKKGVLVEDBasic
NLS Segment(s)
PositionSequence
77-94KRQKEKKKSLWRMKREKK
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, mito 4
Family & Domain DBs
Amino Acid Sequences MTMLDPRGYAASIAPSERSNVGMPDRYRPVSHVPVENGNGVTAPRMSVLAVGGKGPQATVRPVGDEEDEEDAWEEMKRQKEKKKSLWRMKREKKGVLVEDVGEMARFTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.17
5 0.18
6 0.15
7 0.16
8 0.19
9 0.24
10 0.25
11 0.29
12 0.34
13 0.33
14 0.33
15 0.33
16 0.36
17 0.36
18 0.38
19 0.36
20 0.33
21 0.35
22 0.36
23 0.34
24 0.27
25 0.21
26 0.18
27 0.13
28 0.12
29 0.08
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.09
47 0.09
48 0.1
49 0.11
50 0.12
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.11
57 0.11
58 0.1
59 0.1
60 0.09
61 0.1
62 0.11
63 0.19
64 0.26
65 0.33
66 0.42
67 0.51
68 0.61
69 0.7
70 0.77
71 0.81
72 0.86
73 0.89
74 0.91
75 0.92
76 0.93
77 0.93
78 0.9
79 0.86
80 0.83
81 0.81
82 0.74
83 0.68
84 0.6
85 0.5
86 0.42
87 0.36
88 0.28
89 0.19