Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XMJ4

Protein Details
Accession A0A093XMJ4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
285-304TASPAKKPGKAAPPAKKKGKBasic
NLS Segment(s)
PositionSequence
285-304TASPAKKPGKAAPPAKKKGK
Subcellular Location(s) nucl 13cyto_nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MPALTVDTTSPNSSPHQALQNGAPPYAPHGSASPQHSRPSSPPQPPYSPITPTLAAARLDTNVPAIPQQPLRTFTHSSKPDATFIPPPPAPVEVIDFDSNTDVLAVKSAISVLQMQKKKAAQDIRTLQRFKNQAMQDPEAFLRAAEKGEIRTDGDTFPELSDEEDEDGVAGDVVMNGAEERTPEVEGQKEAGARNGTSHAKAQSSFPPLPVPQKVVKVPPINWAQYGVIGDSLEKLHNDQLRHPTPGSPARLGPDGQVLNGYNSTEAEMRDPSPQSPAAGMGKGTASPAKKPGKAAPPAKKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.33
4 0.33
5 0.34
6 0.36
7 0.4
8 0.37
9 0.34
10 0.3
11 0.23
12 0.26
13 0.27
14 0.23
15 0.17
16 0.17
17 0.21
18 0.26
19 0.32
20 0.35
21 0.35
22 0.4
23 0.41
24 0.43
25 0.45
26 0.49
27 0.53
28 0.53
29 0.57
30 0.59
31 0.62
32 0.62
33 0.63
34 0.56
35 0.51
36 0.45
37 0.41
38 0.35
39 0.31
40 0.31
41 0.27
42 0.23
43 0.21
44 0.19
45 0.16
46 0.16
47 0.15
48 0.14
49 0.11
50 0.11
51 0.11
52 0.12
53 0.14
54 0.17
55 0.2
56 0.22
57 0.26
58 0.3
59 0.33
60 0.37
61 0.37
62 0.43
63 0.42
64 0.43
65 0.45
66 0.43
67 0.4
68 0.38
69 0.38
70 0.34
71 0.33
72 0.36
73 0.29
74 0.29
75 0.28
76 0.27
77 0.24
78 0.19
79 0.19
80 0.14
81 0.17
82 0.16
83 0.15
84 0.14
85 0.14
86 0.13
87 0.1
88 0.09
89 0.06
90 0.05
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.08
99 0.11
100 0.19
101 0.22
102 0.22
103 0.27
104 0.29
105 0.3
106 0.33
107 0.37
108 0.32
109 0.38
110 0.46
111 0.49
112 0.54
113 0.54
114 0.48
115 0.47
116 0.47
117 0.4
118 0.4
119 0.33
120 0.33
121 0.37
122 0.39
123 0.33
124 0.32
125 0.31
126 0.23
127 0.22
128 0.15
129 0.1
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.08
136 0.09
137 0.09
138 0.09
139 0.1
140 0.09
141 0.1
142 0.09
143 0.09
144 0.08
145 0.08
146 0.07
147 0.07
148 0.07
149 0.07
150 0.07
151 0.06
152 0.06
153 0.05
154 0.05
155 0.05
156 0.04
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.04
168 0.05
169 0.06
170 0.07
171 0.08
172 0.1
173 0.1
174 0.11
175 0.12
176 0.12
177 0.12
178 0.15
179 0.15
180 0.13
181 0.14
182 0.17
183 0.18
184 0.17
185 0.2
186 0.19
187 0.19
188 0.2
189 0.21
190 0.23
191 0.28
192 0.27
193 0.25
194 0.27
195 0.27
196 0.32
197 0.31
198 0.3
199 0.26
200 0.31
201 0.32
202 0.33
203 0.39
204 0.39
205 0.38
206 0.41
207 0.43
208 0.4
209 0.37
210 0.35
211 0.28
212 0.25
213 0.24
214 0.17
215 0.12
216 0.1
217 0.1
218 0.09
219 0.09
220 0.09
221 0.09
222 0.1
223 0.15
224 0.18
225 0.2
226 0.24
227 0.33
228 0.36
229 0.4
230 0.39
231 0.36
232 0.39
233 0.45
234 0.44
235 0.37
236 0.35
237 0.34
238 0.36
239 0.34
240 0.28
241 0.28
242 0.24
243 0.21
244 0.22
245 0.2
246 0.19
247 0.2
248 0.19
249 0.12
250 0.12
251 0.14
252 0.13
253 0.13
254 0.13
255 0.15
256 0.16
257 0.2
258 0.22
259 0.21
260 0.24
261 0.24
262 0.23
263 0.21
264 0.24
265 0.22
266 0.21
267 0.2
268 0.17
269 0.17
270 0.16
271 0.18
272 0.19
273 0.18
274 0.2
275 0.29
276 0.36
277 0.38
278 0.43
279 0.5
280 0.54
281 0.62
282 0.69
283 0.71
284 0.74