Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XJ20

Protein Details
Accession A0A093XJ20   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
281-304DHVIERRRKKVEGKEKKNLPYARRBasic
NLS Segment(s)
PositionSequence
95-108GKGKSSKEIKRSKK
126-126R
209-236HEKEKLKRTLHSLESKVKAATRKAKEEE
239-243DKHRK
286-299RRRKKVEGKEKKNL
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MSSIKRKALGSSLQRRVRARRNASVELQELSEVSEQDDGANDSEDSIDENAADNNDSDDSGDAEDSESEDSEPGEAASISFGALAKAQESMQRSGKGKSSKEIKRSKKVTDDPWEDNEAAERKAGRKDHRDFSRSNKNAPTEISSKKAVSRKREVVPVIKRDYRDPRFDPSVGQVDDTKINKAYSFLNDYRQDEVKSLKEQLKKTKDEHEKEKLKRTLHSLESKVKAATRKAKEEEILDKHRKEEKQLVREGKTPFYLKKAEQKKQFIMEQYSSLKGKQLDHVIERRRKKVEGKEKKNLPYARRDFGRDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.71
3 0.74
4 0.75
5 0.75
6 0.73
7 0.73
8 0.74
9 0.74
10 0.73
11 0.69
12 0.61
13 0.52
14 0.44
15 0.35
16 0.26
17 0.22
18 0.19
19 0.14
20 0.12
21 0.12
22 0.11
23 0.11
24 0.13
25 0.12
26 0.11
27 0.12
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.09
35 0.07
36 0.08
37 0.09
38 0.09
39 0.1
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.11
76 0.14
77 0.18
78 0.21
79 0.26
80 0.27
81 0.29
82 0.35
83 0.38
84 0.37
85 0.4
86 0.45
87 0.47
88 0.55
89 0.63
90 0.66
91 0.69
92 0.73
93 0.71
94 0.71
95 0.71
96 0.7
97 0.7
98 0.67
99 0.61
100 0.59
101 0.56
102 0.47
103 0.4
104 0.35
105 0.27
106 0.21
107 0.18
108 0.15
109 0.14
110 0.2
111 0.25
112 0.28
113 0.35
114 0.41
115 0.49
116 0.55
117 0.56
118 0.53
119 0.56
120 0.61
121 0.54
122 0.52
123 0.48
124 0.42
125 0.4
126 0.39
127 0.36
128 0.29
129 0.29
130 0.29
131 0.26
132 0.24
133 0.28
134 0.32
135 0.33
136 0.35
137 0.41
138 0.44
139 0.45
140 0.5
141 0.47
142 0.5
143 0.51
144 0.5
145 0.48
146 0.44
147 0.42
148 0.43
149 0.5
150 0.46
151 0.46
152 0.42
153 0.42
154 0.44
155 0.43
156 0.39
157 0.33
158 0.34
159 0.27
160 0.26
161 0.21
162 0.18
163 0.22
164 0.22
165 0.2
166 0.15
167 0.16
168 0.15
169 0.15
170 0.16
171 0.14
172 0.2
173 0.2
174 0.25
175 0.29
176 0.3
177 0.32
178 0.33
179 0.3
180 0.25
181 0.27
182 0.23
183 0.22
184 0.25
185 0.28
186 0.33
187 0.37
188 0.46
189 0.51
190 0.52
191 0.53
192 0.58
193 0.62
194 0.63
195 0.66
196 0.66
197 0.68
198 0.69
199 0.76
200 0.71
201 0.64
202 0.6
203 0.58
204 0.55
205 0.53
206 0.55
207 0.5
208 0.52
209 0.53
210 0.52
211 0.46
212 0.42
213 0.4
214 0.4
215 0.44
216 0.42
217 0.47
218 0.49
219 0.51
220 0.5
221 0.5
222 0.51
223 0.48
224 0.52
225 0.51
226 0.48
227 0.5
228 0.55
229 0.52
230 0.5
231 0.53
232 0.53
233 0.55
234 0.63
235 0.65
236 0.61
237 0.66
238 0.62
239 0.56
240 0.51
241 0.47
242 0.41
243 0.39
244 0.4
245 0.38
246 0.45
247 0.52
248 0.55
249 0.6
250 0.66
251 0.67
252 0.68
253 0.68
254 0.65
255 0.61
256 0.55
257 0.5
258 0.46
259 0.44
260 0.4
261 0.35
262 0.34
263 0.3
264 0.3
265 0.31
266 0.36
267 0.36
268 0.42
269 0.51
270 0.56
271 0.62
272 0.67
273 0.69
274 0.67
275 0.67
276 0.69
277 0.71
278 0.73
279 0.75
280 0.77
281 0.8
282 0.84
283 0.86
284 0.86
285 0.83
286 0.78
287 0.77
288 0.74
289 0.73
290 0.69