Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093ZRR6

Protein Details
Accession A0A093ZRR6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
102-128PISMEPVHPRPHRRRREKKLMTLDEVNHydrophilic
NLS Segment(s)
PositionSequence
111-120RPHRRRREKK
Subcellular Location(s) extr 13, plas 5, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVDASLLHSVLRDTVGLVVRAAVPPTDATADTTTPTASAAPTPSPTDPPSKGGNTQSPLLFFVALGFGVVFTNLWIIVGVKYCFRYNARNRALARGENIDPISMEPVHPRPHRRRREKKLMTLDEVNERFPHIKYADWAAARAHEGLPTAGGVSAPAGSRPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.11
3 0.13
4 0.14
5 0.13
6 0.13
7 0.14
8 0.14
9 0.14
10 0.1
11 0.09
12 0.09
13 0.1
14 0.11
15 0.11
16 0.13
17 0.14
18 0.15
19 0.15
20 0.15
21 0.13
22 0.11
23 0.11
24 0.09
25 0.07
26 0.08
27 0.09
28 0.1
29 0.12
30 0.15
31 0.16
32 0.19
33 0.2
34 0.25
35 0.24
36 0.26
37 0.29
38 0.28
39 0.31
40 0.32
41 0.35
42 0.32
43 0.33
44 0.3
45 0.27
46 0.25
47 0.22
48 0.18
49 0.12
50 0.09
51 0.07
52 0.06
53 0.05
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.06
67 0.06
68 0.07
69 0.09
70 0.09
71 0.11
72 0.13
73 0.22
74 0.27
75 0.37
76 0.4
77 0.45
78 0.45
79 0.49
80 0.5
81 0.43
82 0.38
83 0.31
84 0.29
85 0.24
86 0.24
87 0.18
88 0.15
89 0.14
90 0.14
91 0.1
92 0.1
93 0.11
94 0.14
95 0.22
96 0.26
97 0.35
98 0.43
99 0.54
100 0.64
101 0.73
102 0.8
103 0.83
104 0.9
105 0.91
106 0.9
107 0.91
108 0.86
109 0.8
110 0.74
111 0.66
112 0.63
113 0.55
114 0.46
115 0.36
116 0.32
117 0.28
118 0.23
119 0.27
120 0.18
121 0.19
122 0.2
123 0.25
124 0.29
125 0.27
126 0.28
127 0.23
128 0.24
129 0.24
130 0.23
131 0.18
132 0.14
133 0.14
134 0.13
135 0.13
136 0.11
137 0.1
138 0.08
139 0.08
140 0.07
141 0.06
142 0.08
143 0.08