Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093Y6G3

Protein Details
Accession A0A093Y6G3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
79-101EPEPVPRKRRLGRPPKIKPPGWDBasic
NLS Segment(s)
PositionSequence
84-97PRKRRLGRPPKIKP
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MGRRPGRAAAKQAAVALKNTPQTIEDPEDETMADVPTSEPASPHNQDDDDDPDAEDDGTPAPEDSSPPSEAATPQPEPEPEPVPRKRRLGRPPKIKPPGWDTPDDDFRAYCESFFPRTVMSETC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.32
3 0.27
4 0.25
5 0.25
6 0.24
7 0.22
8 0.19
9 0.2
10 0.24
11 0.25
12 0.23
13 0.22
14 0.22
15 0.22
16 0.21
17 0.19
18 0.15
19 0.11
20 0.09
21 0.06
22 0.06
23 0.07
24 0.08
25 0.08
26 0.07
27 0.1
28 0.16
29 0.18
30 0.19
31 0.19
32 0.18
33 0.19
34 0.21
35 0.22
36 0.18
37 0.16
38 0.15
39 0.13
40 0.13
41 0.12
42 0.1
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.1
53 0.1
54 0.11
55 0.11
56 0.11
57 0.12
58 0.14
59 0.17
60 0.14
61 0.15
62 0.16
63 0.16
64 0.17
65 0.19
66 0.2
67 0.2
68 0.28
69 0.35
70 0.4
71 0.45
72 0.52
73 0.56
74 0.62
75 0.69
76 0.72
77 0.74
78 0.79
79 0.83
80 0.86
81 0.88
82 0.81
83 0.76
84 0.73
85 0.72
86 0.65
87 0.6
88 0.54
89 0.52
90 0.55
91 0.52
92 0.45
93 0.35
94 0.32
95 0.32
96 0.28
97 0.21
98 0.18
99 0.2
100 0.23
101 0.25
102 0.24
103 0.21
104 0.23