Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A094A6G6

Protein Details
Accession A0A094A6G6   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-36VLPMMGYKKYRKHKARKALKKEQLAAHydrophilic
NLS Segment(s)
PositionSequence
18-31KKYRKHKARKALKK
Subcellular Location(s) mito 10.5, extr 7, cyto_mito 6.5, nucl 4, plas 2, cyto 1.5
Family & Domain DBs
Amino Acid Sequences MAAVVLMAIVVLPMMGYKKYRKHKARKALKKEQLAAQPKPLQGGHQAAWEQSGDQPPSYDDTVGALPSPPYSPNRPPGYIERTPREHGPLNSHLHTTYLPPNVLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.1
4 0.16
5 0.26
6 0.36
7 0.47
8 0.57
9 0.67
10 0.76
11 0.84
12 0.89
13 0.91
14 0.91
15 0.92
16 0.9
17 0.86
18 0.8
19 0.75
20 0.73
21 0.69
22 0.61
23 0.57
24 0.52
25 0.45
26 0.44
27 0.37
28 0.29
29 0.26
30 0.27
31 0.21
32 0.19
33 0.19
34 0.16
35 0.17
36 0.15
37 0.12
38 0.1
39 0.13
40 0.11
41 0.1
42 0.11
43 0.1
44 0.13
45 0.13
46 0.12
47 0.08
48 0.09
49 0.1
50 0.09
51 0.09
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.12
58 0.18
59 0.22
60 0.3
61 0.35
62 0.36
63 0.39
64 0.44
65 0.49
66 0.5
67 0.53
68 0.51
69 0.51
70 0.53
71 0.52
72 0.5
73 0.48
74 0.44
75 0.45
76 0.45
77 0.47
78 0.45
79 0.44
80 0.38
81 0.34
82 0.32
83 0.29
84 0.28
85 0.26
86 0.25