Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XZF7

Protein Details
Accession A0A093XZF7   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGHPQRRQRGRRRPQFDDTSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001209  Ribosomal_S14  
IPR018271  Ribosomal_S14_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00253  Ribosomal_S14  
PROSITE View protein in PROSITE  
PS00527  RIBOSOMAL_S14  
Amino Acid Sequences MGHPQRRQRGRRRPQFDDTSLHHFTTPRTAIMSMFRSKKLDLGCFVNIKVIRDHTKRKVFAEHETERQALRYIIRNVTLPNRMRAQAQLELSQMHCYTRPSQIRNRCIEGGKGRGVLRDFKMSRYNFRMHALAGDIPGVKKASW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.78
4 0.74
5 0.67
6 0.64
7 0.58
8 0.51
9 0.43
10 0.35
11 0.32
12 0.34
13 0.3
14 0.23
15 0.22
16 0.22
17 0.21
18 0.26
19 0.3
20 0.28
21 0.29
22 0.31
23 0.31
24 0.31
25 0.33
26 0.32
27 0.3
28 0.26
29 0.28
30 0.29
31 0.28
32 0.28
33 0.29
34 0.27
35 0.24
36 0.23
37 0.23
38 0.27
39 0.31
40 0.38
41 0.42
42 0.49
43 0.5
44 0.51
45 0.54
46 0.49
47 0.5
48 0.51
49 0.45
50 0.41
51 0.41
52 0.4
53 0.32
54 0.3
55 0.25
56 0.17
57 0.15
58 0.17
59 0.17
60 0.18
61 0.19
62 0.19
63 0.19
64 0.22
65 0.28
66 0.23
67 0.23
68 0.24
69 0.24
70 0.25
71 0.25
72 0.25
73 0.23
74 0.23
75 0.21
76 0.2
77 0.2
78 0.2
79 0.2
80 0.16
81 0.13
82 0.12
83 0.13
84 0.15
85 0.23
86 0.29
87 0.32
88 0.41
89 0.5
90 0.57
91 0.6
92 0.63
93 0.57
94 0.53
95 0.54
96 0.5
97 0.46
98 0.4
99 0.39
100 0.34
101 0.35
102 0.35
103 0.34
104 0.32
105 0.37
106 0.35
107 0.35
108 0.43
109 0.42
110 0.48
111 0.49
112 0.5
113 0.43
114 0.46
115 0.44
116 0.36
117 0.35
118 0.3
119 0.25
120 0.21
121 0.2
122 0.18
123 0.16
124 0.18