Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A093Y5P1

Protein Details
Accession A0A093Y5P1    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MCDPREESRRPYNRRWRHRYPEASDSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2
Family & Domain DBs
Amino Acid Sequences MCDPREESRRPYNRRWRHRYPEASDSDIHYSEISAARLQILKLARTPEFGDYIIAAGDIRYPETSADRFKCYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.86
4 0.86
5 0.89
6 0.88
7 0.83
8 0.81
9 0.75
10 0.69
11 0.59
12 0.52
13 0.44
14 0.35
15 0.29
16 0.19
17 0.15
18 0.13
19 0.13
20 0.11
21 0.08
22 0.08
23 0.08
24 0.09
25 0.09
26 0.11
27 0.11
28 0.11
29 0.13
30 0.16
31 0.16
32 0.17
33 0.19
34 0.17
35 0.17
36 0.17
37 0.15
38 0.12
39 0.12
40 0.1
41 0.08
42 0.07
43 0.05
44 0.06
45 0.06
46 0.08
47 0.08
48 0.09
49 0.1
50 0.15
51 0.18
52 0.25
53 0.28