Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JR34

Protein Details
Accession C4JR34    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
67-88LARMNREKERKRLRRLELEAAAHydrophilic
NLS Segment(s)
PositionSequence
75-78ERKR
Subcellular Location(s) mito 9, cyto 6, nucl 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG ure:UREG_03516  -  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MLNSVLRRLQGGNLEVFKFGLYVLFPIGWMYYFGTNLEERFSIPDFWPKSEHSHKIPLEKSDIEAELARMNREKERKRLRRLELEAAAATAGNEGSQAERQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.25
4 0.21
5 0.16
6 0.13
7 0.09
8 0.06
9 0.06
10 0.07
11 0.06
12 0.06
13 0.07
14 0.07
15 0.06
16 0.07
17 0.08
18 0.07
19 0.08
20 0.08
21 0.1
22 0.1
23 0.1
24 0.11
25 0.1
26 0.09
27 0.11
28 0.12
29 0.12
30 0.12
31 0.19
32 0.19
33 0.2
34 0.22
35 0.21
36 0.26
37 0.31
38 0.34
39 0.3
40 0.37
41 0.38
42 0.42
43 0.43
44 0.38
45 0.36
46 0.33
47 0.31
48 0.24
49 0.23
50 0.17
51 0.16
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.16
58 0.21
59 0.3
60 0.36
61 0.43
62 0.54
63 0.62
64 0.7
65 0.78
66 0.8
67 0.81
68 0.82
69 0.81
70 0.72
71 0.66
72 0.56
73 0.46
74 0.38
75 0.27
76 0.2
77 0.12
78 0.08
79 0.05
80 0.05
81 0.05