Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YVW8

Protein Details
Accession A0A093YVW8   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
78-103SSPTKSPSKVEKKPAKPRARKTKAMMHydrophilic
NLS Segment(s)
PositionSequence
78-104SSPTKSPSKVEKKPAKPRARKTKAMMK
Subcellular Location(s) cyto 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MSGQPPSSPAEAGATRAPSALECKFLAAILKNSDGVTNIDWDTVASEAGYNSAATAKVRFGQVKKALGWTVRTAGARSSPTKSPSKVEKKPAKPRARKTKAMMKKEEDAYQMALTQAADDDSNGDEQDDGNGFKKEGANGYKHEDEAVKVEDADEDGDGTLVEEEYASADDYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.2
4 0.2
5 0.15
6 0.2
7 0.18
8 0.18
9 0.16
10 0.17
11 0.17
12 0.17
13 0.19
14 0.17
15 0.2
16 0.19
17 0.21
18 0.2
19 0.2
20 0.2
21 0.18
22 0.17
23 0.14
24 0.14
25 0.13
26 0.12
27 0.11
28 0.11
29 0.1
30 0.09
31 0.08
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.1
45 0.13
46 0.16
47 0.17
48 0.25
49 0.29
50 0.32
51 0.31
52 0.32
53 0.31
54 0.29
55 0.3
56 0.23
57 0.2
58 0.19
59 0.19
60 0.17
61 0.16
62 0.17
63 0.18
64 0.18
65 0.2
66 0.19
67 0.23
68 0.27
69 0.28
70 0.29
71 0.36
72 0.43
73 0.46
74 0.53
75 0.59
76 0.65
77 0.74
78 0.8
79 0.81
80 0.81
81 0.85
82 0.87
83 0.84
84 0.82
85 0.77
86 0.77
87 0.76
88 0.75
89 0.71
90 0.64
91 0.62
92 0.58
93 0.55
94 0.46
95 0.38
96 0.31
97 0.25
98 0.21
99 0.15
100 0.13
101 0.09
102 0.08
103 0.06
104 0.05
105 0.05
106 0.04
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.06
114 0.08
115 0.08
116 0.09
117 0.1
118 0.11
119 0.11
120 0.13
121 0.15
122 0.15
123 0.2
124 0.23
125 0.24
126 0.26
127 0.33
128 0.33
129 0.31
130 0.31
131 0.26
132 0.23
133 0.24
134 0.24
135 0.17
136 0.15
137 0.16
138 0.14
139 0.14
140 0.14
141 0.1
142 0.07
143 0.07
144 0.07
145 0.06
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.07