Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XGT7

Protein Details
Accession A0A093XGT7    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-78AGVSKQDKEARKRDKKEKEKALKREKAEKARLABasic
NLS Segment(s)
PositionSequence
53-77KEARKRDKKEKEKALKREKAEKARL
Subcellular Location(s) nucl 15.5, cyto_nucl 12.833, mito_nucl 9.166, cyto 8
Family & Domain DBs
Amino Acid Sequences MGTDGWQDLDEYQRAQSEEVGELGGETVVASEEPTAAAVEVKASDAGVSKQDKEARKRDKKEKEKALKREKAEKARLAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.16
5 0.15
6 0.14
7 0.13
8 0.1
9 0.09
10 0.08
11 0.07
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.09
35 0.11
36 0.11
37 0.16
38 0.22
39 0.28
40 0.34
41 0.43
42 0.5
43 0.59
44 0.68
45 0.74
46 0.8
47 0.84
48 0.88
49 0.89
50 0.9
51 0.89
52 0.91
53 0.92
54 0.89
55 0.85
56 0.85
57 0.83
58 0.82
59 0.81
60 0.76
61 0.7