Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093X5X8

Protein Details
Accession A0A093X5X8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
148-187PTNTATAPTKKKPRAKPPPPTLRKRRPRERLPRENIDTRHBasic
NLS Segment(s)
PositionSequence
156-180TKKKPRAKPPPPTLRKRRPRERLPR
Subcellular Location(s) nucl 10, cyto 8, mito 3, pero 3, plas 2
Family & Domain DBs
Amino Acid Sequences MFIPYLPHPSMPLVPFYIHPADKISDPQPPVTLSAPAHVIPPSLVLVLAPAPQHHSRAGELHHRASPVRTTTTLAGSAEQGLLDELDLYCVICDDRLSGRLGRGWSRGAKTGGTDKLDWTDHFVGLTGELGGAPYELRHTDDDYTTVPTNTATAPTKKKPRAKPPPPTLRKRRPRERLPRENIDTRHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.26
4 0.29
5 0.24
6 0.24
7 0.24
8 0.24
9 0.24
10 0.28
11 0.25
12 0.26
13 0.27
14 0.28
15 0.27
16 0.26
17 0.27
18 0.24
19 0.26
20 0.2
21 0.19
22 0.2
23 0.18
24 0.18
25 0.16
26 0.15
27 0.11
28 0.11
29 0.1
30 0.08
31 0.08
32 0.06
33 0.07
34 0.07
35 0.09
36 0.08
37 0.07
38 0.12
39 0.14
40 0.16
41 0.17
42 0.17
43 0.17
44 0.19
45 0.22
46 0.26
47 0.28
48 0.29
49 0.3
50 0.29
51 0.28
52 0.28
53 0.28
54 0.22
55 0.22
56 0.2
57 0.2
58 0.2
59 0.21
60 0.21
61 0.17
62 0.15
63 0.12
64 0.12
65 0.09
66 0.08
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.04
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.05
83 0.07
84 0.09
85 0.09
86 0.1
87 0.13
88 0.14
89 0.15
90 0.16
91 0.17
92 0.19
93 0.2
94 0.23
95 0.22
96 0.21
97 0.2
98 0.24
99 0.25
100 0.24
101 0.23
102 0.2
103 0.22
104 0.23
105 0.21
106 0.22
107 0.2
108 0.17
109 0.17
110 0.16
111 0.13
112 0.12
113 0.12
114 0.06
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.03
122 0.05
123 0.06
124 0.08
125 0.1
126 0.12
127 0.14
128 0.15
129 0.17
130 0.16
131 0.2
132 0.19
133 0.18
134 0.16
135 0.14
136 0.14
137 0.13
138 0.16
139 0.16
140 0.22
141 0.29
142 0.38
143 0.48
144 0.56
145 0.65
146 0.71
147 0.78
148 0.83
149 0.86
150 0.89
151 0.89
152 0.92
153 0.92
154 0.93
155 0.93
156 0.92
157 0.93
158 0.92
159 0.92
160 0.92
161 0.93
162 0.94
163 0.94
164 0.94
165 0.92
166 0.92
167 0.89
168 0.87