Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4JE58

Protein Details
Accession C4JE58    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
253-278NIEKPPDLRDIRKKLREQKRAARRQQBasic
NLS Segment(s)
PositionSequence
263-276IRKKLREQKRAARR
Subcellular Location(s) mito 22.5, cyto_mito 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007715  Coq4  
IPR027540  Coq4_euk  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0006744  P:ubiquinone biosynthetic process  
KEGG ure:UREG_00480  -  
Pfam View protein in Pfam  
PF05019  Coq4  
Amino Acid Sequences MATPTSVRIAGFRSLQALCAQRTVTRNFSLLNRPAPNYPGHIPLTPVERGVLAIGSAVGSLLNPRRGDLIATLGETTATPFFIYRLRDAMLSNPTGRRILRDRPRITSQTLSLPYLRSLPPNTVGYTYAAWLDREGVSPDTRSSVQYIDDEECAYVMQRYRECHDFYHAVTGLPIMVEGEIALKAFEFLNTLIPMTGLSVFAAVRLKPEERQRFWSIHLPWAVRSGLASKELINVYWEEQLERDVNELREELNIEKPPDLRDIRKKLREQKRAARRQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.26
4 0.27
5 0.24
6 0.25
7 0.26
8 0.26
9 0.31
10 0.35
11 0.35
12 0.33
13 0.33
14 0.32
15 0.36
16 0.4
17 0.41
18 0.44
19 0.43
20 0.43
21 0.44
22 0.44
23 0.41
24 0.37
25 0.34
26 0.32
27 0.31
28 0.29
29 0.29
30 0.29
31 0.31
32 0.26
33 0.24
34 0.19
35 0.16
36 0.15
37 0.14
38 0.11
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.03
46 0.03
47 0.07
48 0.11
49 0.16
50 0.16
51 0.17
52 0.19
53 0.19
54 0.2
55 0.18
56 0.18
57 0.14
58 0.14
59 0.14
60 0.12
61 0.12
62 0.11
63 0.11
64 0.07
65 0.07
66 0.06
67 0.06
68 0.07
69 0.11
70 0.13
71 0.13
72 0.14
73 0.15
74 0.16
75 0.16
76 0.19
77 0.19
78 0.19
79 0.2
80 0.2
81 0.2
82 0.22
83 0.22
84 0.22
85 0.24
86 0.32
87 0.39
88 0.48
89 0.5
90 0.54
91 0.6
92 0.58
93 0.56
94 0.49
95 0.41
96 0.38
97 0.37
98 0.32
99 0.27
100 0.24
101 0.21
102 0.21
103 0.2
104 0.16
105 0.15
106 0.16
107 0.18
108 0.19
109 0.19
110 0.17
111 0.17
112 0.16
113 0.15
114 0.14
115 0.11
116 0.1
117 0.1
118 0.09
119 0.09
120 0.08
121 0.09
122 0.1
123 0.1
124 0.1
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.11
131 0.1
132 0.11
133 0.11
134 0.13
135 0.12
136 0.11
137 0.11
138 0.1
139 0.09
140 0.08
141 0.07
142 0.07
143 0.07
144 0.1
145 0.12
146 0.14
147 0.18
148 0.22
149 0.23
150 0.23
151 0.26
152 0.25
153 0.23
154 0.27
155 0.24
156 0.2
157 0.19
158 0.17
159 0.13
160 0.1
161 0.1
162 0.04
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.03
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.08
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.05
185 0.05
186 0.06
187 0.06
188 0.07
189 0.09
190 0.08
191 0.1
192 0.12
193 0.14
194 0.19
195 0.29
196 0.37
197 0.4
198 0.47
199 0.49
200 0.48
201 0.51
202 0.55
203 0.47
204 0.44
205 0.44
206 0.38
207 0.35
208 0.36
209 0.32
210 0.24
211 0.22
212 0.18
213 0.15
214 0.16
215 0.16
216 0.13
217 0.17
218 0.18
219 0.17
220 0.16
221 0.16
222 0.15
223 0.18
224 0.18
225 0.14
226 0.14
227 0.17
228 0.17
229 0.16
230 0.17
231 0.18
232 0.18
233 0.2
234 0.2
235 0.17
236 0.17
237 0.19
238 0.18
239 0.21
240 0.25
241 0.25
242 0.27
243 0.28
244 0.29
245 0.35
246 0.38
247 0.4
248 0.46
249 0.55
250 0.63
251 0.71
252 0.78
253 0.81
254 0.87
255 0.88
256 0.88
257 0.88
258 0.89