Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A094A7B4

Protein Details
Accession A0A094A7B4    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
199-224EGDGKTKRTKLNKRRRIVVRIRERALBasic
247-279VEDAEKRTARNRERKIKRREREKRKKAAAAAGIBasic
NLS Segment(s)
PositionSequence
202-274GKTKRTKLNKRRRIVVRIRERALAEKLEAERLRRAREEEEKATRGVEDAEKRTARNRERKIKRREREKRKKAA
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPDAKRVRRDDLYNSDDGNEDAASPIDDSRARHLQDQLAQLYGPITTPSQEPVASGGTEPSPDAPPAEAEDEAFEFRLFAPPTAAVTSNSNPSSIPDVPTTQRIILSNSDDEDLGDGAFTIPHRRLSYYIAAPATGSRKAEFEDVAMSADAVLRGREQRAWALEKPWRVTVIRTGPAYSQSEASPSAKSIDVRAGEGDGKTKRTKLNKRRRIVVRIRERALAEKLEAERLRRAREEEEKATRGVEDAEKRTARNRERKIKRREREKRKKAAAAAGITDPSEGAGSGSGSDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.55
4 0.52
5 0.46
6 0.4
7 0.34
8 0.27
9 0.18
10 0.12
11 0.1
12 0.09
13 0.09
14 0.09
15 0.09
16 0.11
17 0.13
18 0.14
19 0.21
20 0.27
21 0.28
22 0.32
23 0.35
24 0.38
25 0.41
26 0.45
27 0.4
28 0.34
29 0.32
30 0.28
31 0.24
32 0.18
33 0.13
34 0.09
35 0.08
36 0.08
37 0.09
38 0.11
39 0.13
40 0.12
41 0.12
42 0.13
43 0.14
44 0.14
45 0.13
46 0.12
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.11
53 0.12
54 0.11
55 0.11
56 0.13
57 0.15
58 0.13
59 0.11
60 0.12
61 0.12
62 0.12
63 0.12
64 0.1
65 0.08
66 0.08
67 0.14
68 0.14
69 0.13
70 0.14
71 0.13
72 0.15
73 0.17
74 0.17
75 0.12
76 0.16
77 0.17
78 0.21
79 0.21
80 0.19
81 0.18
82 0.18
83 0.23
84 0.2
85 0.21
86 0.17
87 0.2
88 0.21
89 0.24
90 0.24
91 0.19
92 0.19
93 0.18
94 0.19
95 0.18
96 0.2
97 0.18
98 0.17
99 0.16
100 0.15
101 0.14
102 0.12
103 0.1
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.05
110 0.07
111 0.08
112 0.11
113 0.12
114 0.13
115 0.14
116 0.18
117 0.22
118 0.21
119 0.23
120 0.2
121 0.19
122 0.18
123 0.19
124 0.17
125 0.14
126 0.13
127 0.1
128 0.11
129 0.12
130 0.13
131 0.11
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.06
138 0.05
139 0.05
140 0.05
141 0.04
142 0.04
143 0.05
144 0.06
145 0.07
146 0.08
147 0.09
148 0.11
149 0.14
150 0.18
151 0.19
152 0.22
153 0.25
154 0.27
155 0.28
156 0.27
157 0.26
158 0.22
159 0.22
160 0.25
161 0.28
162 0.28
163 0.26
164 0.26
165 0.25
166 0.28
167 0.29
168 0.23
169 0.18
170 0.14
171 0.15
172 0.16
173 0.17
174 0.13
175 0.12
176 0.13
177 0.13
178 0.13
179 0.13
180 0.16
181 0.15
182 0.16
183 0.15
184 0.15
185 0.15
186 0.15
187 0.19
188 0.16
189 0.19
190 0.2
191 0.23
192 0.29
193 0.38
194 0.49
195 0.55
196 0.65
197 0.71
198 0.76
199 0.82
200 0.84
201 0.84
202 0.83
203 0.83
204 0.82
205 0.81
206 0.76
207 0.71
208 0.64
209 0.58
210 0.51
211 0.42
212 0.32
213 0.28
214 0.26
215 0.3
216 0.3
217 0.28
218 0.32
219 0.35
220 0.38
221 0.37
222 0.39
223 0.38
224 0.46
225 0.51
226 0.51
227 0.55
228 0.52
229 0.5
230 0.47
231 0.4
232 0.32
233 0.27
234 0.26
235 0.25
236 0.26
237 0.34
238 0.35
239 0.36
240 0.43
241 0.5
242 0.53
243 0.57
244 0.64
245 0.67
246 0.77
247 0.86
248 0.9
249 0.91
250 0.91
251 0.92
252 0.93
253 0.94
254 0.94
255 0.95
256 0.95
257 0.94
258 0.92
259 0.86
260 0.84
261 0.8
262 0.72
263 0.64
264 0.56
265 0.46
266 0.38
267 0.32
268 0.23
269 0.16
270 0.12
271 0.08
272 0.06
273 0.06
274 0.06
275 0.07