Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XHU6

Protein Details
Accession A0A093XHU6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-88PSTPRKPKTPKTPASRKSKLHydrophilic
NLS Segment(s)
PositionSequence
73-85RKPKTPKTPASRK
Subcellular Location(s) nucl 16, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MPSVWTAEADRDLLLSIIDENKLQGLDWHAIAAKINSKSEKYNFTHEGCRQHFQKLRKASSTGANGSVPSTPRKPKTPKTPASRKSKLLDNNVDDEEAGDVGTPSKKRKLSVAKGERDENGDVKEIDGFGGFEGQTATQFKMESLSSGEEFVDLEDENIYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.09
5 0.09
6 0.09
7 0.09
8 0.1
9 0.1
10 0.1
11 0.1
12 0.12
13 0.13
14 0.13
15 0.14
16 0.13
17 0.14
18 0.14
19 0.14
20 0.17
21 0.17
22 0.2
23 0.22
24 0.23
25 0.28
26 0.31
27 0.37
28 0.35
29 0.4
30 0.42
31 0.42
32 0.48
33 0.47
34 0.53
35 0.48
36 0.51
37 0.45
38 0.48
39 0.51
40 0.49
41 0.53
42 0.52
43 0.54
44 0.51
45 0.52
46 0.46
47 0.46
48 0.46
49 0.39
50 0.32
51 0.27
52 0.24
53 0.22
54 0.22
55 0.16
56 0.15
57 0.18
58 0.22
59 0.25
60 0.33
61 0.4
62 0.46
63 0.56
64 0.63
65 0.67
66 0.71
67 0.78
68 0.78
69 0.81
70 0.78
71 0.72
72 0.64
73 0.62
74 0.59
75 0.56
76 0.55
77 0.47
78 0.45
79 0.41
80 0.38
81 0.31
82 0.24
83 0.17
84 0.1
85 0.08
86 0.04
87 0.04
88 0.05
89 0.08
90 0.1
91 0.12
92 0.19
93 0.21
94 0.23
95 0.31
96 0.41
97 0.47
98 0.57
99 0.63
100 0.65
101 0.66
102 0.68
103 0.6
104 0.54
105 0.47
106 0.37
107 0.29
108 0.24
109 0.2
110 0.18
111 0.17
112 0.14
113 0.12
114 0.1
115 0.08
116 0.06
117 0.08
118 0.07
119 0.07
120 0.07
121 0.07
122 0.09
123 0.11
124 0.12
125 0.12
126 0.12
127 0.12
128 0.14
129 0.14
130 0.13
131 0.14
132 0.17
133 0.16
134 0.17
135 0.17
136 0.14
137 0.14
138 0.13
139 0.12
140 0.08
141 0.08