Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4JSZ4

Protein Details
Accession C4JSZ4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-36EIEKVKKEYEEKMKRKKEKEKEKGKGKEKDKGDBasic
NLS Segment(s)
PositionSequence
9-44KKEYEEKMKRKKEKEKEKGKGKEKDKGDGDEKEKKA
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG ure:UREG_05583  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MEREIEKVKKEYEEKMKRKKEKEKEKGKGKEKDKGDGDEKEKKAETAEDKKAEQEKDEKVAIQGVGTGVSADGDGPRIYALHKNFYQMRLDRIRNMELAKRNRERMKNASFFPSAPKGDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.79
4 0.81
5 0.88
6 0.89
7 0.89
8 0.9
9 0.9
10 0.91
11 0.9
12 0.91
13 0.92
14 0.9
15 0.89
16 0.83
17 0.81
18 0.73
19 0.71
20 0.64
21 0.6
22 0.55
23 0.52
24 0.52
25 0.54
26 0.51
27 0.46
28 0.43
29 0.37
30 0.33
31 0.31
32 0.32
33 0.3
34 0.36
35 0.35
36 0.35
37 0.38
38 0.42
39 0.38
40 0.33
41 0.3
42 0.25
43 0.26
44 0.26
45 0.22
46 0.18
47 0.18
48 0.16
49 0.11
50 0.09
51 0.06
52 0.06
53 0.05
54 0.05
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.12
67 0.14
68 0.19
69 0.2
70 0.25
71 0.27
72 0.29
73 0.35
74 0.31
75 0.36
76 0.39
77 0.41
78 0.41
79 0.43
80 0.43
81 0.39
82 0.4
83 0.4
84 0.41
85 0.46
86 0.51
87 0.54
88 0.6
89 0.66
90 0.7
91 0.71
92 0.71
93 0.73
94 0.7
95 0.67
96 0.65
97 0.58
98 0.51
99 0.5
100 0.48