Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093X187

Protein Details
Accession A0A093X187   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-39ADPGPSSSSTKKRKRKTKDASANAGLHydrophilic
NLS Segment(s)
PositionSequence
24-30KKRKRKT
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MSLSSYLASKYLTADPGPSSSSTKKRKRKTKDASANAGLIIADDDADWAPTRKDDEEDNMAAVTTGSSAEFRKAKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.17
6 0.2
7 0.24
8 0.33
9 0.41
10 0.5
11 0.59
12 0.67
13 0.76
14 0.81
15 0.86
16 0.87
17 0.88
18 0.89
19 0.86
20 0.83
21 0.75
22 0.66
23 0.54
24 0.44
25 0.32
26 0.21
27 0.13
28 0.06
29 0.03
30 0.03
31 0.04
32 0.03
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.09
39 0.1
40 0.11
41 0.13
42 0.18
43 0.22
44 0.23
45 0.23
46 0.2
47 0.19
48 0.17
49 0.15
50 0.1
51 0.05
52 0.05
53 0.05
54 0.06
55 0.08
56 0.14
57 0.18
58 0.2