Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093Y2J4

Protein Details
Accession A0A093Y2J4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
154-173KEGAAPVTKKSKKKAKEEGEBasic
NLS Segment(s)
PositionSequence
161-169TKKSKKKAK
Subcellular Location(s) cyto 16.5, cyto_nucl 12.833, nucl 8, mito_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MADIDNVPLTKVDSAVQGLSSSPPKEKGHRRMSSTAAGVFNINDLEKEGTELLIAKETQKLNWRINKSPTTVEDKDYLKKFLTTPPVKKIDLHFPLGLEVTARNLKGVTIKDALDAIYKQFRKKADDELEAPVLAGFEWDKEESWTRLIVHCKKEGAAPVTKKSKKKAKEEGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.12
6 0.15
7 0.18
8 0.18
9 0.19
10 0.25
11 0.28
12 0.37
13 0.47
14 0.54
15 0.6
16 0.65
17 0.69
18 0.68
19 0.69
20 0.64
21 0.57
22 0.5
23 0.4
24 0.34
25 0.27
26 0.22
27 0.18
28 0.14
29 0.11
30 0.07
31 0.08
32 0.09
33 0.08
34 0.1
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.14
44 0.14
45 0.16
46 0.23
47 0.28
48 0.33
49 0.4
50 0.45
51 0.45
52 0.52
53 0.53
54 0.48
55 0.46
56 0.42
57 0.43
58 0.39
59 0.36
60 0.33
61 0.32
62 0.35
63 0.33
64 0.32
65 0.24
66 0.24
67 0.23
68 0.23
69 0.31
70 0.31
71 0.34
72 0.39
73 0.42
74 0.42
75 0.42
76 0.4
77 0.4
78 0.36
79 0.35
80 0.29
81 0.24
82 0.25
83 0.23
84 0.2
85 0.11
86 0.08
87 0.08
88 0.09
89 0.09
90 0.08
91 0.08
92 0.09
93 0.12
94 0.13
95 0.14
96 0.15
97 0.15
98 0.15
99 0.16
100 0.16
101 0.13
102 0.13
103 0.11
104 0.17
105 0.19
106 0.21
107 0.24
108 0.27
109 0.3
110 0.33
111 0.4
112 0.39
113 0.42
114 0.43
115 0.43
116 0.42
117 0.36
118 0.34
119 0.24
120 0.17
121 0.12
122 0.1
123 0.06
124 0.05
125 0.07
126 0.08
127 0.08
128 0.11
129 0.15
130 0.16
131 0.18
132 0.2
133 0.19
134 0.23
135 0.32
136 0.37
137 0.39
138 0.41
139 0.41
140 0.4
141 0.42
142 0.44
143 0.4
144 0.42
145 0.42
146 0.46
147 0.56
148 0.62
149 0.65
150 0.68
151 0.73
152 0.73
153 0.78
154 0.8