Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093YC74

Protein Details
Accession A0A093YC74    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-74QSCKSSLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKBasic
NLS Segment(s)
PositionSequence
40-66LRGGAKKRKKKVYTTPKKIKHKRKKTK
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002906  Ribosomal_S27a  
IPR011332  Ribosomal_zn-bd  
IPR038582  S27a-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01599  Ribosomal_S27  
Amino Acid Sequences MLPKLYATTAPDQRISSLPTHLRPLRKTIRLSRQSCKSSLRGGAKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRECPTPDCGAGVFMAAMHDRQYCGRCHLTYIFDNENKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.28
4 0.28
5 0.3
6 0.3
7 0.38
8 0.41
9 0.45
10 0.44
11 0.51
12 0.53
13 0.55
14 0.59
15 0.61
16 0.67
17 0.7
18 0.73
19 0.72
20 0.72
21 0.69
22 0.65
23 0.6
24 0.53
25 0.47
26 0.5
27 0.51
28 0.49
29 0.54
30 0.62
31 0.67
32 0.74
33 0.77
34 0.8
35 0.76
36 0.77
37 0.79
38 0.8
39 0.81
40 0.83
41 0.84
42 0.84
43 0.9
44 0.91
45 0.91
46 0.91
47 0.91
48 0.91
49 0.92
50 0.93
51 0.91
52 0.92
53 0.9
54 0.87
55 0.85
56 0.8
57 0.74
58 0.64
59 0.56
60 0.45
61 0.38
62 0.32
63 0.22
64 0.23
65 0.2
66 0.22
67 0.26
68 0.29
69 0.3
70 0.31
71 0.35
72 0.33
73 0.36
74 0.39
75 0.38
76 0.4
77 0.4
78 0.38
79 0.35
80 0.31
81 0.26
82 0.2
83 0.16
84 0.1
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.09
91 0.09
92 0.13
93 0.16
94 0.17
95 0.23
96 0.29
97 0.27
98 0.31
99 0.34
100 0.36
101 0.37
102 0.41
103 0.43