Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A093XHJ4

Protein Details
Accession A0A093XHJ4   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
138-173MYAISVKRQRKLKMKKHKYKKLMKRTRNLRRRLDRNBasic
NLS Segment(s)
PositionSequence
144-173KRQRKLKMKKHKYKKLMKRTRNLRRRLDRN
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences STVRALDGSPSPDTWGADETLRAALAAEPNDITHLDAQDAIPFPQHILTGRYQPFNAPAPPVPMPVDAEAAPEPSQAKRTYTATLTIEESTSPLGEVTYVARSGPLQDVAEPTVPTAFRERMRERRLRYVEERAGGEMYAISVKRQRKLKMKKHKYKKLMKRTRNLRRRLDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.17
4 0.16
5 0.16
6 0.14
7 0.13
8 0.12
9 0.11
10 0.09
11 0.09
12 0.12
13 0.12
14 0.12
15 0.11
16 0.12
17 0.13
18 0.13
19 0.12
20 0.11
21 0.1
22 0.1
23 0.1
24 0.1
25 0.12
26 0.13
27 0.12
28 0.11
29 0.11
30 0.11
31 0.11
32 0.12
33 0.1
34 0.12
35 0.14
36 0.21
37 0.24
38 0.25
39 0.24
40 0.24
41 0.26
42 0.27
43 0.26
44 0.21
45 0.19
46 0.22
47 0.22
48 0.23
49 0.21
50 0.18
51 0.18
52 0.16
53 0.17
54 0.12
55 0.13
56 0.12
57 0.12
58 0.11
59 0.11
60 0.11
61 0.1
62 0.13
63 0.12
64 0.13
65 0.14
66 0.16
67 0.17
68 0.17
69 0.2
70 0.18
71 0.19
72 0.19
73 0.16
74 0.14
75 0.12
76 0.12
77 0.08
78 0.07
79 0.06
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.08
91 0.08
92 0.09
93 0.08
94 0.09
95 0.1
96 0.12
97 0.13
98 0.12
99 0.11
100 0.11
101 0.11
102 0.11
103 0.14
104 0.16
105 0.18
106 0.26
107 0.33
108 0.41
109 0.49
110 0.56
111 0.57
112 0.64
113 0.66
114 0.65
115 0.64
116 0.64
117 0.61
118 0.56
119 0.52
120 0.43
121 0.38
122 0.31
123 0.25
124 0.15
125 0.11
126 0.11
127 0.1
128 0.1
129 0.16
130 0.2
131 0.27
132 0.34
133 0.42
134 0.5
135 0.61
136 0.7
137 0.76
138 0.83
139 0.87
140 0.91
141 0.94
142 0.94
143 0.94
144 0.94
145 0.94
146 0.94
147 0.93
148 0.93
149 0.93
150 0.94
151 0.92
152 0.91
153 0.91